(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE73

ALDEN1_2.PE73        Location/Qualifiers
FT   CDS             80835..82826
FT                   /locus_tag="Alide_0073"
FT                   /gene_family="HOG000225322" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_4093"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_4093 hypothetical protein"
FT                   /db_xref="GI:319760811"
FT                   /db_xref="GeneID:10102096"
FT                   /translation="MADGRLTFLRPLDPDRGGRLVLGDAPEGVPPQQLTGLVFSRPASG
FT                   SGKLTFGKWTEGGEQQIPDAGLSIDAGIAGEGSASVRLRAAALVVVDAGIAGEGAADVR
FT                   FGWDANVSRGGLRAELQALWQQRARPIAAGLATAWQQAAPLRVGAAVRWQDAAPVRGSL
FT                   AAHWQEAERLRAAVVARWQEGERLRAGVDLQWQEAVRLRAAVVARWQEGERRRSALDAR
FT                   WQETLRLRAALSTGWQQAGAARALLVSGWGHGRPVRVHLRTHWQEAMRPRAGVSRLPKP
FT                   PEPRPPCYDPARLGLLVLDTAFTGDGRLLFVCGSAGPTLPPAGIVVPARRSYVVINSIE
FT                   IRRADDLAGDPLPSESFNMQLDRQSWTWTFSAAFHASARDAVAPGVGGQPVELEVRING
FT                   QPFRLQAERIGRSRRFPEHLVTASGRGLAAVLDAPVQTFSAALDRTAHQLMTDVLTVNG
FT                   VGYGWAVDFQLSDWLVPGGIWMHQGTPISALSEIAGAVGGYLQPHDTDAIVRVLPLWPE
FT                   PWWRWDTLAPDIELPDGIAEITETEIIDMPAYDRIFVAGEAGGIQADLTRTGLPGLVLK
FT                   QPMAVHPLITTIGAAKQRATAELAESGRMLKHKMTLPVLPATGVIKPGTVLRYVDDAQA
FT                   LRLGLVRATAISQQFPVLTQSLEIDSHA"
FT                   /protein_id="YP_004124748.1"
     MADGRLTFLR PLDPDRGGRL VLGDAPEGVP PQQLTGLVFS RPASGSGKLT FGKWTEGGEQ        60
     QIPDAGLSID AGIAGEGSAS VRLRAAALVV VDAGIAGEGA ADVRFGWDAN VSRGGLRAEL       120
     QALWQQRARP IAAGLATAWQ QAAPLRVGAA VRWQDAAPVR GSLAAHWQEA ERLRAAVVAR       180
     WQEGERLRAG VDLQWQEAVR LRAAVVARWQ EGERRRSALD ARWQETLRLR AALSTGWQQA       240
     GAARALLVSG WGHGRPVRVH LRTHWQEAMR PRAGVSRLPK PPEPRPPCYD PARLGLLVLD       300
     TAFTGDGRLL FVCGSAGPTL PPAGIVVPAR RSYVVINSIE IRRADDLAGD PLPSESFNMQ       360
     LDRQSWTWTF SAAFHASARD AVAPGVGGQP VELEVRINGQ PFRLQAERIG RSRRFPEHLV       420
     TASGRGLAAV LDAPVQTFSA ALDRTAHQLM TDVLTVNGVG YGWAVDFQLS DWLVPGGIWM       480
     HQGTPISALS EIAGAVGGYL QPHDTDAIVR VLPLWPEPWW RWDTLAPDIE LPDGIAEITE       540
     TEIIDMPAYD RIFVAGEAGG IQADLTRTGL PGLVLKQPMA VHPLITTIGA AKQRATAELA       600
     ESGRMLKHKM TLPVLPATGV IKPGTVLRYV DDAQALRLGL VRATAISQQF PVLTQSLEID       660
     SHA                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page