(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE75

ALDEN1_2.PE75        Location/Qualifiers
FT   CDS             83191..83982
FT                   /locus_tag="Alide_0075"
FT                   /gene_family="HOG000281349" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /codon_start="1"
FT                   /product="d12 class n6 adenine-specific DNA
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: aav:Aave_4108 D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="GI:319760813"
FT                   /db_xref="GO:0009007"
FT                   /db_xref="InterPro:IPR002294"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="GeneID:10102098"
FT                   /translation="MANPIVPWIGGKRRLVDLLLSRFPPHECYCEVFAGGAAVFFARNP
FT                   ASVEVLNDVNGDLVNLYRVVTHHLEEFVRQFKWALTSRQVFKWLQETRPETLTDVQRAA
FT                   RFFYLQQQSFGGKVAGQTWGTATTAPAINLLRIEENLSTAHLRLAGGVYIEQLDWAACI
FT                   DRYDRAHTLFYLDPPYWETEGYGVPFPWEQYVAMAAKLKAIKGKAVVSINDHPAIRECF
FT                   AGYDMEALKLDYTVGGGANRVERGELVIYSWDRLAEPAGLF"
FT                   /protein_id="YP_004124750.1"
     MANPIVPWIG GKRRLVDLLL SRFPPHECYC EVFAGGAAVF FARNPASVEV LNDVNGDLVN        60
     LYRVVTHHLE EFVRQFKWAL TSRQVFKWLQ ETRPETLTDV QRAARFFYLQ QQSFGGKVAG       120
     QTWGTATTAP AINLLRIEEN LSTAHLRLAG GVYIEQLDWA ACIDRYDRAH TLFYLDPPYW       180
     ETEGYGVPFP WEQYVAMAAK LKAIKGKAVV SINDHPAIRE CFAGYDMEAL KLDYTVGGGA       240
     NRVERGELVI YSWDRLAEPA GLF                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page