(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE76

ALDEN1_2.PE76        Location/Qualifiers
FT   CDS             84303..84878
FT                   /locus_tag="Alide_0077"
FT                   /gene_family="HOG000291639" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.17"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; KEGG:
FT                   dia:Dtpsy_0063 ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase"
FT                   /db_xref="GI:319760814"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008817"
FT                   /db_xref="InterPro:IPR002779"
FT                   /db_xref="InterPro:IPR017858"
FT                   /db_xref="GeneID:10102100"
FT                   /translation="MGNRLTQIATRTGDDGTTGLGDNTRVSKASGRPHAMGDVDELNSH
FT                   IGLLLCEPMPQDVRELLIDVQHQLFNLGGELCMPGYELLKDDALLQLDNALARYNAELP
FT                   RLQEFILPAGTRAACQAHVCRTVARRAERAVVALQQAETMRAAPRQYLNRLSDLLFVLS
FT                   RVLNRMDGGNEVYWKSERLARQADDATE"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /protein_id="YP_004124751.1"
     MGNRLTQIAT RTGDDGTTGL GDNTRVSKAS GRPHAMGDVD ELNSHIGLLL CEPMPQDVRE        60
     LLIDVQHQLF NLGGELCMPG YELLKDDALL QLDNALARYN AELPRLQEFI LPAGTRAACQ       120
     AHVCRTVARR AERAVVALQQ AETMRAAPRQ YLNRLSDLLF VLSRVLNRMD GGNEVYWKSE       180
     RLARQADDAT E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page