(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE77

ALDEN1_2.PE77        Location/Qualifiers
FT   CDS             complement(84939..85361)
FT                   /locus_tag="Alide_0078"
FT                   /gene_family="HOG000066991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ajs:Ajs_0044 hypothetical protein"
FT                   /db_xref="GI:319760815"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102101"
FT                   /translation="MSIWKTPISLASVNAHTAHTAISHLGIEFLEVGDDFLRARVPVDE
FT                   RTRQPYGILHGGVSVVLAETLGSMGAANACPPDHRVVGLDINANHIRATSSGWVTGTAR
FT                   PVHIGKSTQVWQIDMVNDEGQLTCVSRITMAVLQPR"
FT                   /protein_id="YP_004124752.1"
     MSIWKTPISL ASVNAHTAHT AISHLGIEFL EVGDDFLRAR VPVDERTRQP YGILHGGVSV        60
     VLAETLGSMG AANACPPDHR VVGLDINANH IRATSSGWVT GTARPVHIGK STQVWQIDMV       120
     NDEGQLTCVS RITMAVLQPR                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page