(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE82

ALDEN1_2.PE82        Location/Qualifiers
FT   CDS             90000..90806
FT                   /locus_tag="Alide_0083"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bbr:BB2766 short chain dehydrogenase"
FT                   /db_xref="GI:319760820"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102106"
FT                   /translation="MTTTSQRLAGKVAIIVGAGQQPGETVGNGRAVAERFAEEGARLLL
FT                   VDIQPESLKDTEDKLRSMGAEVASVLADITREDDCARIAAQCVATFGRIDVLHNNVGRS
FT                   KGDKSTVELGADMWDEIMAMNLKGMFMTCKHVLPQMIAQKEGSIINISSTSSLSARPTV
FT                   AYKTSKGAVNTFTQHLAYENAAHGVRANAILPGLIDTPMAIERRARERGVSREIVRAER
FT                   EAMVPMKRMGTAWDVAHAAVFLASDESRYVTGVLLPVDGGLVCKRG"
FT                   /protein_id="YP_004124757.1"
     MTTTSQRLAG KVAIIVGAGQ QPGETVGNGR AVAERFAEEG ARLLLVDIQP ESLKDTEDKL        60
     RSMGAEVASV LADITREDDC ARIAAQCVAT FGRIDVLHNN VGRSKGDKST VELGADMWDE       120
     IMAMNLKGMF MTCKHVLPQM IAQKEGSIIN ISSTSSLSAR PTVAYKTSKG AVNTFTQHLA       180
     YENAAHGVRA NAILPGLIDT PMAIERRARE RGVSREIVRA EREAMVPMKR MGTAWDVAHA       240
     AVFLASDESR YVTGVLLPVD GGLVCKRG                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page