(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE83

ALDEN1_2.PE83        Location/Qualifiers
FT   CDS             90808..91569
FT                   /locus_tag="Alide_0084"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0736 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319760821"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102107"
FT                   /translation="MNLRLQGSHVLVTGASRGIGKACVRAFLDEGATVSALARTQQTLE
FT                   AMAAQMQAGDRLRVFCADLQDAAQAQEAVRRIEAQGGPIQVLVNCAGAAKRTPFAQLQP
FT                   ADWHAGMQAKFYSYMHVLTPVVQRMAGRGAGAVVNVVGAGGKRANPVHLAGGAANAALM
FT                   LAGTGLAAAYAPSGVRINTINPGQVRTERLQAQRDAQAAAGGAPLAEPPLGRPAEPEEI
FT                   AALAVFLASPRASYVSGAVIAMDGVALPTVV"
FT                   /protein_id="YP_004124758.1"
     MNLRLQGSHV LVTGASRGIG KACVRAFLDE GATVSALART QQTLEAMAAQ MQAGDRLRVF        60
     CADLQDAAQA QEAVRRIEAQ GGPIQVLVNC AGAAKRTPFA QLQPADWHAG MQAKFYSYMH       120
     VLTPVVQRMA GRGAGAVVNV VGAGGKRANP VHLAGGAANA ALMLAGTGLA AAYAPSGVRI       180
     NTINPGQVRT ERLQAQRDAQ AAAGGAPLAE PPLGRPAEPE EIAALAVFLA SPRASYVSGA       240
     VIAMDGVALP TVV                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page