(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE84

ALDEN1_2.PE84        Location/Qualifiers
FT   CDS             91601..92116
FT                   /locus_tag="Alide_0085"
FT                   /gene_family="HOG000071411" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /codon_start="1"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   pol:Bpro_2144 carboxymuconolactone decarboxylase"
FT                   /db_xref="GI:319760822"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="GeneID:10102108"
FT                   /translation="MRIAPITPGTRPELAELEATITRQRGRVSPLYQVLLNSPAMAHGW
FT                   EQMLTAVRRHNSLPDLDRELLIVRVAVLNHARFEYEAHVPIALQAGASSQMIADVSGAD
FT                   AIGASVQGGLRALVELADAMTSRIDVPDALYAQAAAYYTQQQMVDAMVTIGAYNMVSRF
FT                   LEAVQIGH"
FT                   /protein_id="YP_004124759.1"
     MRIAPITPGT RPELAELEAT ITRQRGRVSP LYQVLLNSPA MAHGWEQMLT AVRRHNSLPD        60
     LDRELLIVRV AVLNHARFEY EAHVPIALQA GASSQMIADV SGADAIGASV QGGLRALVEL       120
     ADAMTSRIDV PDALYAQAAA YYTQQQMVDA MVTIGAYNMV SRFLEAVQIG H                171
//

If you have problems or comments...

PBIL Back to PBIL home page