(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE87

ALDEN1_2.PE87        Location/Qualifiers
FT   CDS             complement(94398..95666)
FT                   /locus_tag="Alide_0088"
FT                   /gene_family="HOG000255771" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /codon_start="1"
FT                   /product="ubiquinone biosynthesis hydroxylase,
FT                   ubih/ubif/visc/coq6 family"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0052 hypothetical protein; TIGRFAM:
FT                   Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6
FT                   family; PFAM: monooxygenase FAD-binding"
FT                   /db_xref="GI:319760825"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="GeneID:10102111"
FT                   /translation="MPPQQTNTHSSSDVLIVGAGPAGLSLAASLAQAGMQVTVLEQQPA
FT                   SVLAAPPPDGREIALTHPSVATLQRLGSWQRLAAHEVGLLREAQVHDGPVGRRGAMQLH
FT                   AGGSGVDHLGWIVPNYALRRTAYEVAAQQPDVRIVTEARVARVAVTPAHAELEYTDARQ
FT                   GGQGAERLQAPLLVAADSRFSATRRQLGIGAAMHDFGRTVIVCRLRHELPHHEVAHECF
FT                   GYEQTLAILPLPNDPIDGAPMCSAVVTTGAAQAQQLMALPPEEYAARVQAQFQNRLGAM
FT                   RLVGERHAYPLVAVYAHRFAGPRCALLGDAAVGMHPVTAHGYNLGLAGVEGLTRAVAGA
FT                   WARGADIGAASVLAPYAREHHRHAWPLYQGTNAIVRLYTDDRPLPRLLRQAVLAGSNRL
FT                   PPLKGLIVSQLTGRRPAWPTAAP"
FT                   /protein_id="YP_004124762.1"
     MPPQQTNTHS SSDVLIVGAG PAGLSLAASL AQAGMQVTVL EQQPASVLAA PPPDGREIAL        60
     THPSVATLQR LGSWQRLAAH EVGLLREAQV HDGPVGRRGA MQLHAGGSGV DHLGWIVPNY       120
     ALRRTAYEVA AQQPDVRIVT EARVARVAVT PAHAELEYTD ARQGGQGAER LQAPLLVAAD       180
     SRFSATRRQL GIGAAMHDFG RTVIVCRLRH ELPHHEVAHE CFGYEQTLAI LPLPNDPIDG       240
     APMCSAVVTT GAAQAQQLMA LPPEEYAARV QAQFQNRLGA MRLVGERHAY PLVAVYAHRF       300
     AGPRCALLGD AAVGMHPVTA HGYNLGLAGV EGLTRAVAGA WARGADIGAA SVLAPYAREH       360
     HRHAWPLYQG TNAIVRLYTD DRPLPRLLRQ AVLAGSNRLP PLKGLIVSQL TGRRPAWPTA       420
     AP                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page