(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE88

ALDEN1_2.PE88        Location/Qualifiers
FT   CDS             95836..97911
FT                   /locus_tag="Alide_0089"
FT                   /gene_family="HOG000229992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /codon_start="1"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0074 acetoacetyl-CoA synthetase;
FT                   TIGRFAM: acetoacetyl-CoA synthase; PFAM: AMP-dependent
FT                   synthetase and ligase"
FT                   /db_xref="GI:319760826"
FT                   /db_xref="GO:0030729"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:10102112"
FT                   /translation="METDSPPPYVPQIRLYQDWLQARRGLRFDGYDALWRWSVTELDAF
FT                   WQSVWDYFDLQSPTPHDAVLARNVMPGARWFPGAQVNYARQVLRHVDAAHAAGQPALVA
FT                   RNERGQHRELSWPALRRQVAALALHLKAQGVGPGDRVAAYLPNIPETIVAFLACASIGA
FT                   VWSVCAPDMGTNAVLDRFRQIEPKVLFAVDGVSYGGRDHDRCAVLAELRAQLPTLRHVV
FT                   LVNNLDATKTIADTACYASITARKDAETAAFEPLWLPFDHPLWIVYSSGTTGMPKPIVH
FT                   GHGGMLLVMLQLAVLHNDIGCSYAPNSFGERFHWYSSTGWIMWNAQVGGLLGGTTCVLY
FT                   DGNPGGSKERPDWGVLWRMAAETGVTFFGAGAAFYGNCMKAGITPAQCGDLSAIRALGS
FT                   TGSPLPAEVQQWGSDFMAVAGVPRVWWANISGGTDFAGAFLGGHRELPQTPGRMQCRML
FT                   GAAVEAWDEQGRPVLDAVGELVCTQPIPSMPLYLWGDADGARYRASYFDMYPPGHGRRP
FT                   GGGDLGPEAGAVWRHGDWIEIGSAAHPGCLIYGRSDATINRHGLRMGTSEIYSAVEALP
FT                   EVLDSLVVDLEYLGRESWMPLFVVLREGVALDDALRGRIDDAIRAALSPRFVPDDIFAV
FT                   AEVPRTLSGKKQELPIKKLLLGQPLAKVVNRDAMANPGCLDWYVDFAARRGAAAAA"
FT                   /protein_id="YP_004124763.1"
     METDSPPPYV PQIRLYQDWL QARRGLRFDG YDALWRWSVT ELDAFWQSVW DYFDLQSPTP        60
     HDAVLARNVM PGARWFPGAQ VNYARQVLRH VDAAHAAGQP ALVARNERGQ HRELSWPALR       120
     RQVAALALHL KAQGVGPGDR VAAYLPNIPE TIVAFLACAS IGAVWSVCAP DMGTNAVLDR       180
     FRQIEPKVLF AVDGVSYGGR DHDRCAVLAE LRAQLPTLRH VVLVNNLDAT KTIADTACYA       240
     SITARKDAET AAFEPLWLPF DHPLWIVYSS GTTGMPKPIV HGHGGMLLVM LQLAVLHNDI       300
     GCSYAPNSFG ERFHWYSSTG WIMWNAQVGG LLGGTTCVLY DGNPGGSKER PDWGVLWRMA       360
     AETGVTFFGA GAAFYGNCMK AGITPAQCGD LSAIRALGST GSPLPAEVQQ WGSDFMAVAG       420
     VPRVWWANIS GGTDFAGAFL GGHRELPQTP GRMQCRMLGA AVEAWDEQGR PVLDAVGELV       480
     CTQPIPSMPL YLWGDADGAR YRASYFDMYP PGHGRRPGGG DLGPEAGAVW RHGDWIEIGS       540
     AAHPGCLIYG RSDATINRHG LRMGTSEIYS AVEALPEVLD SLVVDLEYLG RESWMPLFVV       600
     LREGVALDDA LRGRIDDAIR AALSPRFVPD DIFAVAEVPR TLSGKKQELP IKKLLLGQPL       660
     AKVVNRDAMA NPGCLDWYVD FAARRGAAAA A                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page