(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE89

ALDEN1_2.PE89        Location/Qualifiers
FT   CDS             complement(97943..98872)
FT                   /locus_tag="Alide_0090"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ajs:Ajs_0055 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760827"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102113"
FT                   /translation="MNLRQLSQFVTLAETGNFHRAAERLHMAQPPLSVSIRKLEEELGS
FT                   ALFARTRTGVALTPAGQAMLDDARRTLLHAQQCRQAVLDTREGTGGRLRLGIIGSATYA
FT                   LLPRLIPSLRARYPQITLELSEATSSEILEGLVSRRFDAGLLRFPLLDASGFDLTPLDR
FT                   DDFVLAVAETSPLARREAIALHEAAHEPFIMYPRSKVPGLLALAMMRCQFSGFAPQVAQ
FT                   EAAQVQTIMSLVASGLGVGLVAGVARQVVPRGVKCLRLTDNPPGFHVSIALARLAGNTS
FT                   RVVQRFAEHALECAGAPHVEGGGGGGPG"
FT                   /protein_id="YP_004124764.1"
     MNLRQLSQFV TLAETGNFHR AAERLHMAQP PLSVSIRKLE EELGSALFAR TRTGVALTPA        60
     GQAMLDDARR TLLHAQQCRQ AVLDTREGTG GRLRLGIIGS ATYALLPRLI PSLRARYPQI       120
     TLELSEATSS EILEGLVSRR FDAGLLRFPL LDASGFDLTP LDRDDFVLAV AETSPLARRE       180
     AIALHEAAHE PFIMYPRSKV PGLLALAMMR CQFSGFAPQV AQEAAQVQTI MSLVASGLGV       240
     GLVAGVARQV VPRGVKCLRL TDNPPGFHVS IALARLAGNT SRVVQRFAEH ALECAGAPHV       300
     EGGGGGGPG                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page