(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE9

ALDEN1_2.PE9         Location/Qualifiers
FT   CDS             complement(10084..11856)
FT                   /locus_tag="Alide_0009"
FT                   /gene_family="HOG000258966" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   reh:H16_A2141 hypothetical protein"
FT                   /db_xref="GI:319760747"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="GeneID:10102032"
FT                   /translation="MNQTVLIGGASGFWGDSQIAVPQLLRQPGLQYLVFDYLAETTMSI
FT                   LQRARLRAPELGYATDFVTAAVGPHLREIKAKGVRLVSNAGGLNPAGCRDAILALAREQ
FT                   GVDLKVAIVTGDDVLDLQPRFEPWGDEATADLPALMSANAYLGAAPVAQALAAGADIVV
FT                   TGRCVDSASLLGIAIHEFGWRMTDYDRLAQASLAGHLVECGAQATGGLFTDWEQVPDWA
FT                   DIGYPLVRLQADGSFELSQPEGAGGLVTRQTVGEQLLYEIGDPAAYELPDVVCDFTQVA
FT                   ITDLDGGRVRVQGARGRAPGGRYKVTATYQQGWHIAIMMAIRGQRALAKAQRTADALLA
FT                   RTRRQMQAAGFADYEDTLVELLGAESMYGPHRRVADSREIVLRIAARHRDRRALAFLQK
FT                   EASSAGTSMGPGTRSHFGGRSDVQSIIRTASFLLPKAAVAVQVQAAPDEAPAAVEAADA
FT                   AAAPAAPNPPEATAAGAAASGPTVRIALGRIAHGRSGDKGDDANIGLMARDPKWLPVLR
FT                   GQLTAERVLQYFAHLVQGPVQRYELPGLGAFNFVLRRALGGGGSCSLRSDPLGKCYAQM
FT                   LLDMEIDCPEDLAP"
FT                   /protein_id="YP_004124684.1"
     MNQTVLIGGA SGFWGDSQIA VPQLLRQPGL QYLVFDYLAE TTMSILQRAR LRAPELGYAT        60
     DFVTAAVGPH LREIKAKGVR LVSNAGGLNP AGCRDAILAL AREQGVDLKV AIVTGDDVLD       120
     LQPRFEPWGD EATADLPALM SANAYLGAAP VAQALAAGAD IVVTGRCVDS ASLLGIAIHE       180
     FGWRMTDYDR LAQASLAGHL VECGAQATGG LFTDWEQVPD WADIGYPLVR LQADGSFELS       240
     QPEGAGGLVT RQTVGEQLLY EIGDPAAYEL PDVVCDFTQV AITDLDGGRV RVQGARGRAP       300
     GGRYKVTATY QQGWHIAIMM AIRGQRALAK AQRTADALLA RTRRQMQAAG FADYEDTLVE       360
     LLGAESMYGP HRRVADSREI VLRIAARHRD RRALAFLQKE ASSAGTSMGP GTRSHFGGRS       420
     DVQSIIRTAS FLLPKAAVAV QVQAAPDEAP AAVEAADAAA APAAPNPPEA TAAGAAASGP       480
     TVRIALGRIA HGRSGDKGDD ANIGLMARDP KWLPVLRGQL TAERVLQYFA HLVQGPVQRY       540
     ELPGLGAFNF VLRRALGGGG SCSLRSDPLG KCYAQMLLDM EIDCPEDLAP                  590
//

If you have problems or comments...

PBIL Back to PBIL home page