(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE94

ALDEN1_2.PE94        Location/Qualifiers
FT   CDS             103126..103749
FT                   /locus_tag="Alide_0095"
FT                   /gene_family="HOG000229371" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /codon_start="1"
FT                   /product="cdp-diacylglycerol/serine
FT                   o-phosphatidyltransferase"
FT                   /transl_table="11"
FT                   /note="manually curated; TIGRFAM: CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase; KEGG: dia:Dtpsy_0083
FT                   CDP-diacylglycerol/serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="GI:319760832"
FT                   /db_xref="GO:0003882"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="GeneID:10102118"
FT                   /translation="MASPHKRFSMIREFHLADWFTLGNAVCGVGALFSSMTYLETADLR
FT                   HVYFACALVLAALVFDVLDGRIARWRQKSSAMGRELDSLADVISFGVAPAIIAYACGMQ
FT                   GLYDRIVLAFFVACGVSRLARFNITAETLAEGPSGKVRYFEGTPIPTSIVLVGLLALAA
FT                   STGAVREHLWLGKMMIGGFTLHPLVLLFALSGSLMISRIRIPKL"
FT                   /protein_id="YP_004124769.1"
     MASPHKRFSM IREFHLADWF TLGNAVCGVG ALFSSMTYLE TADLRHVYFA CALVLAALVF        60
     DVLDGRIARW RQKSSAMGRE LDSLADVISF GVAPAIIAYA CGMQGLYDRI VLAFFVACGV       120
     SRLARFNITA ETLAEGPSGK VRYFEGTPIP TSIVLVGLLA LAASTGAVRE HLWLGKMMIG       180
     GFTLHPLVLL FALSGSLMIS RIRIPKL                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page