(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE96

ALDEN1_2.PE96        Location/Qualifiers
FT   CDS             106062..107231
FT                   /locus_tag="Alide_0097"
FT                   /gene_family="HOG000225368" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:NE2432"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: neu:NE2432 hypothetical protein"
FT                   /db_xref="GI:319760834"
FT                   /db_xref="GeneID:10102120"
FT                   /translation="MSTRAWTWVHKWSSLVCTAFMLLLCLTGLPLIFHEEIEHLPGAVE
FT                   AAPMPEGTPEASMDRIAQAARERRPDDVIRYMFWDPEEHPNLTYVSMASRVDAPPDENN
FT                   AVVVDSRTAQVLDEPRTNEGFMYVMLKLHVDMFAGLPGMLFLGFMGLLMVVAIVSGVVL
FT                   YYPFMRRLRFGALRTRRSARIRWLDWHNLLGIVTVVWLTVVGITGSINTLDRIILAIWQ
FT                   QDQMAEMTAPYKGLPPVTRPAHLQKSIEAARAAAPDMAVRLVAFPGTAFSSPHHYTFFL
FT                   KGGTPVTSRLLKPALVDAQTGVLTASRDMPWYVKTLFLSQPLHFGDYGGLPLKILWTLL
FT                   DLAAIVVLGSGLYLWLRKPRAAPVPGAEAEPDAEPDAELAPVAAVEAKT"
FT                   /protein_id="YP_004124771.1"
     MSTRAWTWVH KWSSLVCTAF MLLLCLTGLP LIFHEEIEHL PGAVEAAPMP EGTPEASMDR        60
     IAQAARERRP DDVIRYMFWD PEEHPNLTYV SMASRVDAPP DENNAVVVDS RTAQVLDEPR       120
     TNEGFMYVML KLHVDMFAGL PGMLFLGFMG LLMVVAIVSG VVLYYPFMRR LRFGALRTRR       180
     SARIRWLDWH NLLGIVTVVW LTVVGITGSI NTLDRIILAI WQQDQMAEMT APYKGLPPVT       240
     RPAHLQKSIE AARAAAPDMA VRLVAFPGTA FSSPHHYTFF LKGGTPVTSR LLKPALVDAQ       300
     TGVLTASRDM PWYVKTLFLS QPLHFGDYGG LPLKILWTLL DLAAIVVLGS GLYLWLRKPR       360
     AAPVPGAEAE PDAEPDAELA PVAAVEAKT                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page