(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE97

ALDEN1_2.PE97        Location/Qualifiers
FT   CDS             107228..107437
FT                   /locus_tag="Alide_0098"
FT                   /gene_family="HOG000289419" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rpal_2080"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpt:Rpal_2080 hypothetical protein"
FT                   /db_xref="GI:319760835"
FT                   /db_xref="GeneID:10102121"
FT                   /translation="MTMPTGPRRDARTDEAQPAAEIFRVPILLGLATAVGLVSALVGDG
FT                   VWDALSWLALAAPAAAVAWAWRAR"
FT                   /protein_id="YP_004124772.1"
     MTMPTGPRRD ARTDEAQPAA EIFRVPILLG LATAVGLVSA LVGDGVWDAL SWLALAAPAA        60
     AVAWAWRAR                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page