(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE98

ALDEN1_2.PE98        Location/Qualifiers
FT   CDS             107604..108365
FT                   /locus_tag="Alide_0099"
FT                   /gene_family="HOG000062060" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /codon_start="1"
FT                   /product="septum site-determining protein minc"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0084 septum site-determining protein
FT                   MinC; TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC"
FT                   /db_xref="GI:319760836"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="GeneID:10102122"
FT                   /translation="MAVDTAGQARTYLDLKSAQLSVVALVLKTADVSAVAAELAARRAD
FT                   DPEFFDNDPVLIDLSAVQGEAQPIDFAALVQALRSHRTQPVAVRGGSPAQMAAAHAAGL
FT                   IAAPDVPAARAQPRESGAVREVVREVVREVQVEVPVQAPAPGALVVDKPLRSGQQVYAR
FT                   GSDLVVMAVVSFGAEVIADGNIHVYAPLRGRAIAGARGDTSARIFTTCLEPQLVSVAGI
FT                   YRTTETELPDNVRGKPAQVRLDGEKLLIEPL"
FT                   /protein_id="YP_004124773.1"
     MAVDTAGQAR TYLDLKSAQL SVVALVLKTA DVSAVAAELA ARRADDPEFF DNDPVLIDLS        60
     AVQGEAQPID FAALVQALRS HRTQPVAVRG GSPAQMAAAH AAGLIAAPDV PAARAQPRES       120
     GAVREVVREV VREVQVEVPV QAPAPGALVV DKPLRSGQQV YARGSDLVVM AVVSFGAEVI       180
     ADGNIHVYAP LRGRAIAGAR GDTSARIFTT CLEPQLVSVA GIYRTTETEL PDNVRGKPAQ       240
     VRLDGEKLLI EPL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page