(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE99

ALDEN1_2.PE99        Location/Qualifiers
FT   CDS             108420..109235
FT                   /locus_tag="Alide_0100"
FT                   /gene_family="HOG000019419" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01968"
FT                   /codon_start="1"
FT                   /product="septum site-determining protein mind"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: septum site-determining protein MinD; KEGG:
FT                   dia:Dtpsy_0085 septum site-determining protein MinD"
FT                   /db_xref="GI:319760837"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="GeneID:10102123"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSAAFASGLALAGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLNQALIKDKQCENLFVLAASQTRDKDALTQEGVEK
FT                   VLKDLADMGFDYIVCDSPAGIESGALMAMHFADEALLVTNPEVSSVRDSDRILGMLGSK
FT                   TKRAIEGKDPIKEHLLITRYNPNRVQDGQMLGLEDIQDILRIKLIGVVPESENVLQASN
FT                   QGLPAIHLAGTDVSEAYKDVVARFLGEDKPLRFTDAAKPGFFKRIFGGR"
FT                   /protein_id="YP_004124774.1"
     MAKIVVVTSG KGGVGKTTTS AAFASGLALA GHKTAVIDFD VGLRNLDLIM GCERRVVYDL        60
     INVIQGEANL NQALIKDKQC ENLFVLAASQ TRDKDALTQE GVEKVLKDLA DMGFDYIVCD       120
     SPAGIESGAL MAMHFADEAL LVTNPEVSSV RDSDRILGML GSKTKRAIEG KDPIKEHLLI       180
     TRYNPNRVQD GQMLGLEDIQ DILRIKLIGV VPESENVLQA SNQGLPAIHL AGTDVSEAYK       240
     DVVARFLGED KPLRFTDAAK PGFFKRIFGG R                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page