(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE1

ALIAD_1.PE1          Location/Qualifiers
FT   CDS             112..1476
FT                   /locus_tag="Aaci_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: geo:Geob_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="GI:258510021"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="GeneID:8426153"
FT                   /translation="MMSTKVDPTYDALWNQVLQMVQDKVSGPTYSTWFEDTHIVRIDES
FT                   EQTVYISAPSTFVRNWLSEHYTSLVETLMMTLMDREYRVRFITEDDVQAPAVIVRRAPE
FT                   PVTAEEDTETNLNPRYTFDSFVIGAGNRFAHAACLAVAERPANAYNPLFIYGGVGLGKT
FT                   HLMHAIGHYVRQHYPNFKVSYISSERFTNEFIAAIRDKNPDSFRARYRTVDVLLIDDIQ
FT                   FIANKEQTQEEFFHTFNSLHEVGKQIVISSDRPPREIPTLEDRLRSRFEWGLITDIQPP
FT                   DLETRIAILQRKAKADGLDVPVDVLAFIANQIDSNIRELEGALTRVIAYSSLVKEDLSV
FT                   ALAEEALKDLIHPNRPRAVTVNHVQKVVADHYGLKVDDLKGKKRTRNIAFPRQIAMYLT
FT                   RELTDLSLPRIGEAFGGRDHTTVMHACERVHEEMMRDDELRATIERLSQAIRTLT"
FT                   /protein_id="YP_003183455.1"
     MMSTKVDPTY DALWNQVLQM VQDKVSGPTY STWFEDTHIV RIDESEQTVY ISAPSTFVRN        60
     WLSEHYTSLV ETLMMTLMDR EYRVRFITED DVQAPAVIVR RAPEPVTAEE DTETNLNPRY       120
     TFDSFVIGAG NRFAHAACLA VAERPANAYN PLFIYGGVGL GKTHLMHAIG HYVRQHYPNF       180
     KVSYISSERF TNEFIAAIRD KNPDSFRARY RTVDVLLIDD IQFIANKEQT QEEFFHTFNS       240
     LHEVGKQIVI SSDRPPREIP TLEDRLRSRF EWGLITDIQP PDLETRIAIL QRKAKADGLD       300
     VPVDVLAFIA NQIDSNIREL EGALTRVIAY SSLVKEDLSV ALAEEALKDL IHPNRPRAVT       360
     VNHVQKVVAD HYGLKVDDLK GKKRTRNIAF PRQIAMYLTR ELTDLSLPRI GEAFGGRDHT       420
     TVMHACERVH EEMMRDDELR ATIERLSQAI RTLT                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page