(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE10

ALIAD_1.PE10         Location/Qualifiers
FT   CDS             10137..10520
FT                   /locus_tag="Aaci_0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510030"
FT                   /db_xref="GeneID:8423468"
FT                   /translation="MAKAVAPGVEGGSAVKAETLEDVLRDPEFRRQYPPEFLKVLEDPK
FT                   FGQEFQRFVEWAESLIDTKNIGKMSLDELAESVAKRLWGVVLTMFERQVIEMERAGRDV
FT                   SHLRAWLARHGRFPEREDEEGDA"
FT                   /protein_id="YP_003183464.1"
     MAKAVAPGVE GGSAVKAETL EDVLRDPEFR RQYPPEFLKV LEDPKFGQEF QRFVEWAESL        60
     IDTKNIGKMS LDELAESVAK RLWGVVLTMF ERQVIEMERA GRDVSHLRAW LARHGRFPER       120
     EDEEGDA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page