(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE13

ALIAD_1.PE13         Location/Qualifiers
FT   CDS             18694..19275
FT                   /locus_tag="Aaci_0013"
FT                   /gene_family="HOG000039949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /codon_start="1"
FT                   /product="SNO glutamine amidotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   dds:Ddes_1897 SNO glutamine amidotransferase"
FT                   /db_xref="GI:258510033"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="GeneID:8423474"
FT                   /translation="MKIAVIAVQGAFREHIAALKSLGVEAYEAKWARDLEGADGVIIPG
FT                   GESTAIGKLMREYDMLEPVRALARAGKPIYGTCAGMIVLAKRIEGEDTVHLGLMDVTVR
FT                   RNSFGRQRESFEAEIDIPAIGAPPFPAVFIRAPHIVSVGEGVEVLATYEDRIVAVRQGN
FT                   LLATSFHPELTDDYRLHQYFLNMAQAPVAH"
FT                   /protein_id="YP_003183467.1"
     MKIAVIAVQG AFREHIAALK SLGVEAYEAK WARDLEGADG VIIPGGESTA IGKLMREYDM        60
     LEPVRALARA GKPIYGTCAG MIVLAKRIEG EDTVHLGLMD VTVRRNSFGR QRESFEAEID       120
     IPAIGAPPFP AVFIRAPHIV SVGEGVEVLA TYEDRIVAVR QGNLLATSFH PELTDDYRLH       180
     QYFLNMAQAP VAH                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page