(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE15

ALIAD_1.PE15         Location/Qualifiers
FT   CDS             20594..21067
FT                   /locus_tag="Aaci_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510035"
FT                   /db_xref="GeneID:8423476"
FT                   /translation="MRISNIRVRLSADDLNSMIAEFAPDIPLRILAIQPDGVHGQFKFL
FT                   MWNIDFAARPTCSADKGEISIEISARKLVNIPPAIVQMSLQEAMKDAPQGIEVLRQSLR
FT                   LNIASLLEPLGIALKLNEFTCAEGALVIDLARVEVEMKGRTSELRSMWKRRGE"
FT                   /protein_id="YP_003183469.1"
     MRISNIRVRL SADDLNSMIA EFAPDIPLRI LAIQPDGVHG QFKFLMWNID FAARPTCSAD        60
     KGEISIEISA RKLVNIPPAI VQMSLQEAMK DAPQGIEVLR QSLRLNIASL LEPLGIALKL       120
     NEFTCAEGAL VIDLARVEVE MKGRTSELRS MWKRRGE                                157
//

If you have problems or comments...

PBIL Back to PBIL home page