(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE17

ALIAD_1.PE17         Location/Qualifiers
FT   CDS             complement(23592..24635)
FT                   /locus_tag="Aaci_0017"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ping_2688"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pin:Ping_2688 hypothetical protein"
FT                   /db_xref="GI:258510037"
FT                   /db_xref="GeneID:8423479"
FT                   /translation="MTPLERLRERYRLRIQERGVRADEMLDVLREIYSQRVRNLMMAMI
FT                   SSCLIADWVSSQAMDPSVLTPEMTEAFHLQYPHLTFDDLRRMSPAELQGVVNGWSGKLF
FT                   EVMVRDMLNKGEWVGDIHLQPGQHAVLADSPTQPGWDIRIVNADGSTDELLQLKATSSL
FT                   SYVKAAIEQHPNIHVIATSDVFDHGTQLSDALLDHVTNSGIGEDMLREFINDTLSGNDT
FT                   RHHFLEALEPGLPLLMILAQELRQVRAGSKSAKAAKKEAFTRLLKSGSISLVTHGLHAL
FT                   GATTGITVPVSFLMRTGMTRISVFNQLTYKLEKRTQELQKWYQMSTWNKPPERSFSYGR
FT                   SASEHNT"
FT                   /protein_id="YP_003183471.1"
     MTPLERLRER YRLRIQERGV RADEMLDVLR EIYSQRVRNL MMAMISSCLI ADWVSSQAMD        60
     PSVLTPEMTE AFHLQYPHLT FDDLRRMSPA ELQGVVNGWS GKLFEVMVRD MLNKGEWVGD       120
     IHLQPGQHAV LADSPTQPGW DIRIVNADGS TDELLQLKAT SSLSYVKAAI EQHPNIHVIA       180
     TSDVFDHGTQ LSDALLDHVT NSGIGEDMLR EFINDTLSGN DTRHHFLEAL EPGLPLLMIL       240
     AQELRQVRAG SKSAKAAKKE AFTRLLKSGS ISLVTHGLHA LGATTGITVP VSFLMRTGMT       300
     RISVFNQLTY KLEKRTQELQ KWYQMSTWNK PPERSFSYGR SASEHNT                     347
//

If you have problems or comments...

PBIL Back to PBIL home page