(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE18

ALIAD_1.PE18         Location/Qualifiers
FT   CDS             complement(25130..26248)
FT                   /locus_tag="Aaci_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /codon_start="1"
FT                   /product="nuclease (SNase domain protein)"
FT                   /transl_table="11"
FT                   /note="PFAM: nuclease (SNase domain protein); SMART:
FT                   nuclease (SNase domain protein); KEGG: hypothetical
FT                   protein"
FT                   /db_xref="GI:258510038"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="GeneID:8423480"
FT                   /translation="MFRKNVWKSSLFALGGLAVSFFVGLVPTAVADSRVGLHAPTGLMA
FT                   ATVTRDIDGDTMQVRIGPKTETVRMLLIDTPEQVDPKTPVEPYAREASAYAKRLLPVGK
FT                   RVWLQEGHPGHTRDKYGRLLAYVWITSTDLYNRDVVDQGLARVAYVYAPNTDYLAQLEA
FT                   AQNDAKWHHRGIWSIPGYVTSQGFNLDVAQKWLQAHSSSNRSSSGEDETSHGGFPVSSS
FT                   SGGKNSSVGIGNAGFPPPSQTNSNASSPDWGSAVGPSTSVSPDPSTPVGRAPASDTAEG
FT                   QSSITVISSDLNVQRGGYASVTIQTTPGALGTIEVDYKTGPSHASGLEPKTADSSGRIT
FT                   WEWRVGSSTTAGQWPVTIAVGGQSITLTLSVS"
FT                   /protein_id="YP_003183472.1"
     MFRKNVWKSS LFALGGLAVS FFVGLVPTAV ADSRVGLHAP TGLMAATVTR DIDGDTMQVR        60
     IGPKTETVRM LLIDTPEQVD PKTPVEPYAR EASAYAKRLL PVGKRVWLQE GHPGHTRDKY       120
     GRLLAYVWIT STDLYNRDVV DQGLARVAYV YAPNTDYLAQ LEAAQNDAKW HHRGIWSIPG       180
     YVTSQGFNLD VAQKWLQAHS SSNRSSSGED ETSHGGFPVS SSSGGKNSSV GIGNAGFPPP       240
     SQTNSNASSP DWGSAVGPST SVSPDPSTPV GRAPASDTAE GQSSITVISS DLNVQRGGYA       300
     SVTIQTTPGA LGTIEVDYKT GPSHASGLEP KTADSSGRIT WEWRVGSSTT AGQWPVTIAV       360
     GGQSITLTLS VS                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page