(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE19

ALIAD_1.PE19         Location/Qualifiers
FT   CDS             complement(26460..26741)
FT                   /locus_tag="Aaci_0019"
FT                   /gene_family="HOG000130865" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0150"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   dvl:Dvul_2770 hypothetical protein"
FT                   /db_xref="GI:258510039"
FT                   /db_xref="InterPro:IPR005357"
FT                   /db_xref="GeneID:8423481"
FT                   /translation="MATRGYPAIFDPYEDGSFVVLFPDFPGCVTQGCNLDDAVAMAEEA
FT                   LTLQLYGIERDGEDLPEPSDPSHVTVPEEVQGQWFVMLIHPRPELFHP"
FT                   /protein_id="YP_003183473.1"
     MATRGYPAIF DPYEDGSFVV LFPDFPGCVT QGCNLDDAVA MAEEALTLQL YGIERDGEDL        60
     PEPSDPSHVT VPEEVQGQWF VMLIHPRPEL FHP                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page