(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE20

ALIAD_1.PE20         Location/Qualifiers
FT   CDS             27889..29079
FT                   /locus_tag="Aaci_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510040"
FT                   /db_xref="GeneID:8423483"
FT                   /translation="MSSRRWLVAGFFAPIVVICIFMFTFIPAVRSAGERLSELKVAVVN
FT                   EAGSQGVALQKQLAKHLPFTAITGLDERAARQKLLTGNVEMVIRIPSDFYEKLASGNAH
FT                   LDFELTDALSPNVKSMMQLTEARVTQATNAAVLEVAKWKLDNALMKQVDVAPANTSQSK
FT                   EVAVSAAQREVFLVKLMQQIQRFPTQPVRANEVVVASAPAVAEFLPFLTVVTFFIGSIL
FT                   ASLAAWFALKPFDGSARRRYMAWFETLGYILIVSFAAAATVVGVAQMYGVYPVVHAFRA
FT                   VCSLAISFGAGCGLVGGLIYLLRLPGIGLYALLFPFQMLSSGIALPFDMLPQGYQSVVR
FT                   VLPALHVTRVVNWLYVGVGDVSADLKWLGLTVLLAALVMGLRLVFVRRRQVKEDSI"
FT                   /protein_id="YP_003183474.1"
     MSSRRWLVAG FFAPIVVICI FMFTFIPAVR SAGERLSELK VAVVNEAGSQ GVALQKQLAK        60
     HLPFTAITGL DERAARQKLL TGNVEMVIRI PSDFYEKLAS GNAHLDFELT DALSPNVKSM       120
     MQLTEARVTQ ATNAAVLEVA KWKLDNALMK QVDVAPANTS QSKEVAVSAA QREVFLVKLM       180
     QQIQRFPTQP VRANEVVVAS APAVAEFLPF LTVVTFFIGS ILASLAAWFA LKPFDGSARR       240
     RYMAWFETLG YILIVSFAAA ATVVGVAQMY GVYPVVHAFR AVCSLAISFG AGCGLVGGLI       300
     YLLRLPGIGL YALLFPFQML SSGIALPFDM LPQGYQSVVR VLPALHVTRV VNWLYVGVGD       360
     VSADLKWLGL TVLLAALVMG LRLVFVRRRQ VKEDSI                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page