(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE22

ALIAD_1.PE22         Location/Qualifiers
FT   CDS             complement(30921..31895)
FT                   /locus_tag="Aaci_0023"
FT                   /gene_family="HOG000246674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.41"
FT                   /transl_table="11"
FT                   /note="KEGG: xca:xccb100_3342 3-oxoacyl-(acyl carrier
FT                   protein) synthase III; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; 3-Oxoacyl-[acyl-carrier- protein (ACP)] synthase
FT                   III"
FT                   /db_xref="GI:258510042"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="GeneID:8423485"
FT                   /translation="MYKAVIRGVGSYLPETRLTNVEIEQMVATSDEWIQTRTGIAERRI
FT                   ARPDEATSDFAYLAAQAALADAKLHPTDIDLLIVATETPDYLLPPVACQVQARLGCRNI
FT                   GAFDLHATCAGFLSALQVAEQFVKSGVHEHVLIVGADTLSRFTDYTDRGTCILFADGAG
FT                   AFVVSRSDDRAARGVIATTIHSDGTYFHNLYIPGGGSRTPYGDGAKAKIVMDGRKIFKL
FT                   AVNVMSSTVEELLQKTGRQRDEIDWLIPHQANQRIIDAVAESLDFPQEKVVSTIQNIGN
FT                   NSSATIPIAVDTAIRDGRIQRGDLLMLVAFGGGLVWGGAMVEY"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /protein_id="YP_003183476.1"
     MYKAVIRGVG SYLPETRLTN VEIEQMVATS DEWIQTRTGI AERRIARPDE ATSDFAYLAA        60
     QAALADAKLH PTDIDLLIVA TETPDYLLPP VACQVQARLG CRNIGAFDLH ATCAGFLSAL       120
     QVAEQFVKSG VHEHVLIVGA DTLSRFTDYT DRGTCILFAD GAGAFVVSRS DDRAARGVIA       180
     TTIHSDGTYF HNLYIPGGGS RTPYGDGAKA KIVMDGRKIF KLAVNVMSST VEELLQKTGR       240
     QRDEIDWLIP HQANQRIIDA VAESLDFPQE KVVSTIQNIG NNSSATIPIA VDTAIRDGRI       300
     QRGDLLMLVA FGGGLVWGGA MVEY                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page