(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE25

ALIAD_1.PE25         Location/Qualifiers
FT   CDS             complement(34001..35365)
FT                   /locus_tag="Aaci_0026"
FT                   /gene_family="HOG000029894" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG0438"
FT                   /codon_start="1"
FT                   /product="Glycosyltransferase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: azo:azo3253 hypothetical protein"
FT                   /db_xref="GI:258510045"
FT                   /db_xref="GeneID:8423488"
FT                   /translation="MKRRHALIICHDFPPVGGIAVQRPLKFAKYLGEFGWKVTVLTADH
FT                   VYSATPDPSLLDEIPGDVQIVRVTDPVSKQLARWSGRIVGDGSTPAPQASAQARLPLWK
FT                   RLAWGAWKWAQEHALIPDESVVWAIRAGFAARRIVRQRVMDCIYTTSGPQSTQLAGLIA
FT                   SAFTRTPWIADFRDPWTDNLHFHHRGWRAALERRLERMVFARAAAIVTVTDGFWRLFAA
FT                   KYPRRALDIHVIRNGVDEADFPPAPARRRSEGEPFTFFYGGILYSGRSADALFQAVHRL
FT                   LQSGHIAPHRIRIQFAGVLDYPGHHHHARLIRELGLEAVIEPLGYLPRREALARMLAAD
FT                   ATLLIGDQSEQAKDYVPGKLYEYLYAGRPILAMLREGEAADLIRREQAGIIVPPDDPDA
FT                   IAQAMLHLMAQPATERRAWNPAYSRRAQAQQLARLMDDVLAVQTESTAWSMSWDG"
FT                   /protein_id="YP_003183479.1"
     MKRRHALIIC HDFPPVGGIA VQRPLKFAKY LGEFGWKVTV LTADHVYSAT PDPSLLDEIP        60
     GDVQIVRVTD PVSKQLARWS GRIVGDGSTP APQASAQARL PLWKRLAWGA WKWAQEHALI       120
     PDESVVWAIR AGFAARRIVR QRVMDCIYTT SGPQSTQLAG LIASAFTRTP WIADFRDPWT       180
     DNLHFHHRGW RAALERRLER MVFARAAAIV TVTDGFWRLF AAKYPRRALD IHVIRNGVDE       240
     ADFPPAPARR RSEGEPFTFF YGGILYSGRS ADALFQAVHR LLQSGHIAPH RIRIQFAGVL       300
     DYPGHHHHAR LIRELGLEAV IEPLGYLPRR EALARMLAAD ATLLIGDQSE QAKDYVPGKL       360
     YEYLYAGRPI LAMLREGEAA DLIRREQAGI IVPPDDPDAI AQAMLHLMAQ PATERRAWNP       420
     AYSRRAQAQQ LARLMDDVLA VQTESTAWSM SWDG                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page