(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE27

ALIAD_1.PE27         Location/Qualifiers
FT   CDS             37187..38470
FT                   /locus_tag="Aaci_0028"
FT                   /gene_family="HOG000238475" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01346"
FT                   /codon_start="1"
FT                   /product="isocitrate lyase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: sml:Smlt0232 putative
FT                   isocitrate lyase"
FT                   /db_xref="GI:258510047"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="GeneID:8423490"
FT                   /translation="MTYFKTAAELEQHWKTDPRWKGVERAYTAEDVIRLRGSVHIEHTL
FT                   AQMGAEKLWRGLHEDGFIRALGALTGNQAVQQVKAGLKAIYVSGWQVAADANLAEHMYP
FT                   DQSLYPSNSVPSLVRRINNALLRADQIQTAEGKGDIDWMVPIVADAEAGFGGPLNVFEL
FT                   MKMMIEAGAAGVHFEDQLSSEKKCGHMGGKVLIPTSHAVRNLTAARLAADVLGVPTVIV
FT                   ARTDANGAFLITSDVDDRDARFITGERTPEGFYRFRGGLEAAIARGLAYAPYADMIWCE
FT                   TSEPNIEEAKRFAEAIKAEFPDKLLAYNCSPSFNWRKKLDPKTIEEFQEIIASFGYKFQ
FT                   FVTLAGFHALNYSMFELAYGYNQRGMGAYSDLQQQEFAAEARGYTATRHQREVGTGYFD
FT                   EVAQVVSGGLSSTTALTGSTEEEQFVEA"
FT                   /protein_id="YP_003183481.1"
     MTYFKTAAEL EQHWKTDPRW KGVERAYTAE DVIRLRGSVH IEHTLAQMGA EKLWRGLHED        60
     GFIRALGALT GNQAVQQVKA GLKAIYVSGW QVAADANLAE HMYPDQSLYP SNSVPSLVRR       120
     INNALLRADQ IQTAEGKGDI DWMVPIVADA EAGFGGPLNV FELMKMMIEA GAAGVHFEDQ       180
     LSSEKKCGHM GGKVLIPTSH AVRNLTAARL AADVLGVPTV IVARTDANGA FLITSDVDDR       240
     DARFITGERT PEGFYRFRGG LEAAIARGLA YAPYADMIWC ETSEPNIEEA KRFAEAIKAE       300
     FPDKLLAYNC SPSFNWRKKL DPKTIEEFQE IIASFGYKFQ FVTLAGFHAL NYSMFELAYG       360
     YNQRGMGAYS DLQQQEFAAE ARGYTATRHQ REVGTGYFDE VAQVVSGGLS STTALTGSTE       420
     EEQFVEA                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page