(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE29

ALIAD_1.PE29         Location/Qualifiers
FT   CDS             complement(42063..42980)
FT                   /locus_tag="Aaci_0030"
FT                   /gene_family="HOG000010453" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG: scl:sce7756
FT                   uncharacterized ABC-type transport system,permease
FT                   component"
FT                   /db_xref="GI:258510049"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:8423492"
FT                   /translation="MVFSNPEIWALTLSMAIPLALPAVGGTFSERTGVVNIAMEGIMLI
FT                   GAFFGVAFSYWTGNAWIGLLAAIVCGALTALALAWGAIHVSADQTVLGMGINIFAAGLT
FT                   TFLLNTLFGYNGTPVNTPKLPSVSIPGLDRLPYIGVIFTNQSVLVYIGIVLIFLSHWFL
FT                   FSTRLGLRMRSVGENPLAADTLGIPVWRLRYFGVVLSGVFSAIGGAYLSIGILNGFTSN
FT                   MTSGRGYIALAAMIFGKWTPLGSFGAALIFGFSTALGIVLQGHGVSSNILQMIPYALTI
FT                   LALTGLIGRSTPPAADGIPYEPRR"
FT                   /protein_id="YP_003183483.1"
     MVFSNPEIWA LTLSMAIPLA LPAVGGTFSE RTGVVNIAME GIMLIGAFFG VAFSYWTGNA        60
     WIGLLAAIVC GALTALALAW GAIHVSADQT VLGMGINIFA AGLTTFLLNT LFGYNGTPVN       120
     TPKLPSVSIP GLDRLPYIGV IFTNQSVLVY IGIVLIFLSH WFLFSTRLGL RMRSVGENPL       180
     AADTLGIPVW RLRYFGVVLS GVFSAIGGAY LSIGILNGFT SNMTSGRGYI ALAAMIFGKW       240
     TPLGSFGAAL IFGFSTALGI VLQGHGVSSN ILQMIPYALT ILALTGLIGR STPPAADGIP       300
     YEPRR                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page