(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE3

ALIAD_1.PE3          Location/Qualifiers
FT   CDS             2828..3058
FT                   /locus_tag="Aaci_0003"
FT                   /gene_family="HOG000074028" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /codon_start="1"
FT                   /product="S4 domain protein YaaA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG: gsu:GSU0464
FT                   S4 domain-containing protein"
FT                   /db_xref="GI:258510023"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="GeneID:8423461"
FT                   /translation="MDVHIRGEHITLGQLLKKVQIVASGGEVKSFLAEGRVRVNGAMET
FT                   RRGRKLRDGDEVEVEGAVYRVVSEPDGHPPR"
FT                   /protein_id="YP_003183457.1"
     MDVHIRGEHI TLGQLLKKVQ IVASGGEVKS FLAEGRVRVN GAMETRRGRK LRDGDEVEVE        60
     GAVYRVVSEP DGHPPR                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page