(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE31

ALIAD_1.PE31         Location/Qualifiers
FT   CDS             complement(44087..45625)
FT                   /locus_tag="Aaci_0032"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce7755 sugar ABC transporter, ATP- binding
FT                   protein"
FT                   /db_xref="GI:258510051"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8423494"
FT                   /translation="MEAIPALEPVLEVVDLKKWFPGVKANDGVNLTVQAGEVHAILGEN
FT                   GAGKSTLMKVIYGLLEPTSGEIRLFGQPVHFRSPRDAILAGIGMVHQHFMLIPALTVAE
FT                   NVVLGDEPGGLRFDRREAVRRVRELSERYGLAIDPNAKVGDLTVGLQQRVEILKAFYRK
FT                   ARVLILDEPTALLTPQETRELFNIIRALKAEGVPVLFISHKLDEVLEISDRVTVMRAGK
FT                   TVETLETKGATPQMLANLMVGREVVLRVEKPPMEAGSPVLEVRNLRVRSADRHERVKGV
FT                   SLTVRRGEILGIAGIDGNGQFELADAIAGLLRAEAGQIALDGRDITHLSPADRTQLGIA
FT                   YVPQDRQLDGLVLSFDLADNIILRDFRRPPFSRRGILNRRAAESYAKRLIEAFDVRPPD
FT                   FRRKASELSGGNQQKVILAREVSRDPLVLIAAQPTRGLDVGAIEGVHRQLVRLRNEGKA
FT                   VLLISLELDEILSLSDRIAVMHDGEIVGVVNGAEATREQLGLMMTGRRAKEGTA"
FT                   /protein_id="YP_003183485.1"
     MEAIPALEPV LEVVDLKKWF PGVKANDGVN LTVQAGEVHA ILGENGAGKS TLMKVIYGLL        60
     EPTSGEIRLF GQPVHFRSPR DAILAGIGMV HQHFMLIPAL TVAENVVLGD EPGGLRFDRR       120
     EAVRRVRELS ERYGLAIDPN AKVGDLTVGL QQRVEILKAF YRKARVLILD EPTALLTPQE       180
     TRELFNIIRA LKAEGVPVLF ISHKLDEVLE ISDRVTVMRA GKTVETLETK GATPQMLANL       240
     MVGREVVLRV EKPPMEAGSP VLEVRNLRVR SADRHERVKG VSLTVRRGEI LGIAGIDGNG       300
     QFELADAIAG LLRAEAGQIA LDGRDITHLS PADRTQLGIA YVPQDRQLDG LVLSFDLADN       360
     IILRDFRRPP FSRRGILNRR AAESYAKRLI EAFDVRPPDF RRKASELSGG NQQKVILARE       420
     VSRDPLVLIA AQPTRGLDVG AIEGVHRQLV RLRNEGKAVL LISLELDEIL SLSDRIAVMH       480
     DGEIVGVVNG AEATREQLGL MMTGRRAKEG TA                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page