(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE32

ALIAD_1.PE32         Location/Qualifiers
FT   CDS             complement(45683..46753)
FT                   /locus_tag="Aaci_0033"
FT                   /gene_family="HOG000010227" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /codon_start="1"
FT                   /product="basic membrane lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   mxa:MXAN_5711 Bmp family lipoprotein"
FT                   /db_xref="GI:258510052"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="GeneID:8423495"
FT                   /translation="MQKRIWQSGLSILAAAALVVGCGTNNSSSATNTSNNGSTGNTTST
FT                   SGKTIKVGLVTDTGGLNDNSFNHLAYVGMQEAQKELPNIQTSVVQSQSESDYVPNLSHF
FT                   AQDGYDLVIAVGYLMADAVQQVAKEYPKTHFLIIDDSITGIPNVASAIFQSQQAGYLAG
FT                   VVAGMVQKNHLLKNINSHNTVGVVGGQEIPPVDTYIAGFQQGFHSVDPTGKVIVEYTNS
FT                   FSDEAAGSQYAQNEIAQGADIIFPVAGGTGIGSIKAAQSAKVYAIGVDTDQSYLAPGTV
FT                   ITSAIKRVDTSVFDTIKAVQDGTFKSGVNTFDLANNGVGIAPLISGLPKSVTDAVNQAK
FT                   QEILSGKIQVSATVQK"
FT                   /protein_id="YP_003183486.1"
     MQKRIWQSGL SILAAAALVV GCGTNNSSSA TNTSNNGSTG NTTSTSGKTI KVGLVTDTGG        60
     LNDNSFNHLA YVGMQEAQKE LPNIQTSVVQ SQSESDYVPN LSHFAQDGYD LVIAVGYLMA       120
     DAVQQVAKEY PKTHFLIIDD SITGIPNVAS AIFQSQQAGY LAGVVAGMVQ KNHLLKNINS       180
     HNTVGVVGGQ EIPPVDTYIA GFQQGFHSVD PTGKVIVEYT NSFSDEAAGS QYAQNEIAQG       240
     ADIIFPVAGG TGIGSIKAAQ SAKVYAIGVD TDQSYLAPGT VITSAIKRVD TSVFDTIKAV       300
     QDGTFKSGVN TFDLANNGVG IAPLISGLPK SVTDAVNQAK QEILSGKIQV SATVQK           356
//

If you have problems or comments...

PBIL Back to PBIL home page