(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE33

ALIAD_1.PE33         Location/Qualifiers
FT   CDS             47066..47635
FT                   /locus_tag="Aaci_0034"
FT                   /gene_family="HOG000078668" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /codon_start="1"
FT                   /product="isochorismatase hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bav:BAV0718
FT                   isochorismatase-family hydrolase"
FT                   /db_xref="GI:258510053"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="GeneID:8423496"
FT                   /translation="MASDVKQTALLVMDVQNGIVSRYIQDAPAMRPFQEAVSAARKAGI
FT                   QVIFVRVAFSEGFPEASPRNKMFAHLAQAGNMTVSADSTQIHESVRPEAGEPVVTKYRV
FT                   SAFAGSNLEVILRAKDITHLVLCGIATSGVVLSTLREAADKDYALIVLKDACLDADPEV
FT                   HRVLVEKVFPRQADVMTVEEWAKTLV"
FT                   /protein_id="YP_003183487.1"
     MASDVKQTAL LVMDVQNGIV SRYIQDAPAM RPFQEAVSAA RKAGIQVIFV RVAFSEGFPE        60
     ASPRNKMFAH LAQAGNMTVS ADSTQIHESV RPEAGEPVVT KYRVSAFAGS NLEVILRAKD       120
     ITHLVLCGIA TSGVVLSTLR EAADKDYALI VLKDACLDAD PEVHRVLVEK VFPRQADVMT       180
     VEEWAKTLV                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page