(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE34

ALIAD_1.PE34         Location/Qualifiers
FT   CDS             47654..48286
FT                   /locus_tag="Aaci_0035"
FT                   /gene_family="HOG000058039" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bbt:BBta_2483 putative beta-lactamase"
FT                   /db_xref="GI:258510054"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="GeneID:8423497"
FT                   /translation="MEIAPKIHLLECTKGSYSYLVLGDEPVLVDTSMPGRADAMVKALA
FT                   SLGLKPGDLAHIVLTHLDVDHIGNAKRLKELSGATLWAPAPDIPYIEGAEKPKGVRRAI
FT                   AGLMRVERPKVDRALEPGAHVGGLEVVPAPGHTPGHVCLIARDTLLAGDLVTTRGGRLK
FT                   KSPSFLTWDKAALRQSLADVGRLSFDWVCPAHGDPVRRGSLWEALLE"
FT                   /protein_id="YP_003183488.1"
     MEIAPKIHLL ECTKGSYSYL VLGDEPVLVD TSMPGRADAM VKALASLGLK PGDLAHIVLT        60
     HLDVDHIGNA KRLKELSGAT LWAPAPDIPY IEGAEKPKGV RRAIAGLMRV ERPKVDRALE       120
     PGAHVGGLEV VPAPGHTPGH VCLIARDTLL AGDLVTTRGG RLKKSPSFLT WDKAALRQSL       180
     ADVGRLSFDW VCPAHGDPVR RGSLWEALLE                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page