(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE36

ALIAD_1.PE36         Location/Qualifiers
FT   CDS             48839..49336
FT                   /locus_tag="Aaci_0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510056"
FT                   /db_xref="GeneID:8423499"
FT                   /translation="MRRIRRLRMAVAIVASAAWLAGCGSPTGYQPQPPAPGVSEFWQIM
FT                   QIRVPEDDAQRFVMDLGLATREREGNYSFWMSALTWRALGKRDHASLYELVIPNCCNIA
FT                   LPSTTVTYGQASNSLVQTVDFEQDERNAVFYISASQPLQWSQTATDAKHQTVSLVFVPV
FT                   AS"
FT                   /protein_id="YP_003183490.1"
     MRRIRRLRMA VAIVASAAWL AGCGSPTGYQ PQPPAPGVSE FWQIMQIRVP EDDAQRFVMD        60
     LGLATREREG NYSFWMSALT WRALGKRDHA SLYELVIPNC CNIALPSTTV TYGQASNSLV       120
     QTVDFEQDER NAVFYISASQ PLQWSQTATD AKHQTVSLVF VPVAS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page