(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE39

ALIAD_1.PE39         Location/Qualifiers
FT   CDS             complement(50942..52591)
FT                   /locus_tag="Aaci_0040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_7115 ABC
FT                   transporter, permease protein"
FT                   /db_xref="GI:258510059"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8423502"
FT                   /translation="MMWRTSWHTAAGTAVLAAAAAVLCVYPVFDLAVELPSAAVLASTL
FT                   GPLWNALWTSAVSSAIASLVGMAWAVMLSGAVRRGRAALHAISLLPLWTPPFIGAFALG
FT                   DAYARAGLLDQWAHVHVGWLYGPWGVTAALAIHAAPIGYLSGLTAIAAMNVEPMWAARS
FT                   CGAGWFRAFWAAFRPVALRPLCAAWALSFAFALGDFGVPYELGEPSGFRTAATSIFANL
FT                   STGGTQGFTAATWQAFELMAVGALAVTVSRGVMRFDPGLGTSAPGAPPLPLFPKRARAI
FT                   SLAAYALYVATTSGLPLAALVLTALTRAYGLPPTPRNWDAAGLLSPLVSAWPALVHTVV
FT                   LATVAAAVIALLGLVAAEAVPASAMARAAHLALWLQYAAPGTAVAVAILVAFGHALYGT
FT                   WWILGLAYVAKFYGLADAIVAARRNAQLDPWRAARSFGAGPAGAYGAAIWPAIRPAVRQ
FT                   VALQALMSGLYEVTLASLLYGPNTQTIAVAVLSASEGGDVRTVAVLAVWMTAASFALGL
FT                   LALREPKRRRSQGLSQLRMAMPAAPLEEVKLG"
FT                   /protein_id="YP_003183493.1"
     MMWRTSWHTA AGTAVLAAAA AVLCVYPVFD LAVELPSAAV LASTLGPLWN ALWTSAVSSA        60
     IASLVGMAWA VMLSGAVRRG RAALHAISLL PLWTPPFIGA FALGDAYARA GLLDQWAHVH       120
     VGWLYGPWGV TAALAIHAAP IGYLSGLTAI AAMNVEPMWA ARSCGAGWFR AFWAAFRPVA       180
     LRPLCAAWAL SFAFALGDFG VPYELGEPSG FRTAATSIFA NLSTGGTQGF TAATWQAFEL       240
     MAVGALAVTV SRGVMRFDPG LGTSAPGAPP LPLFPKRARA ISLAAYALYV ATTSGLPLAA       300
     LVLTALTRAY GLPPTPRNWD AAGLLSPLVS AWPALVHTVV LATVAAAVIA LLGLVAAEAV       360
     PASAMARAAH LALWLQYAAP GTAVAVAILV AFGHALYGTW WILGLAYVAK FYGLADAIVA       420
     ARRNAQLDPW RAARSFGAGP AGAYGAAIWP AIRPAVRQVA LQALMSGLYE VTLASLLYGP       480
     NTQTIAVAVL SASEGGDVRT VAVLAVWMTA ASFALGLLAL REPKRRRSQG LSQLRMAMPA       540
     APLEEVKLG                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page