(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE40

ALIAD_1.PE40         Location/Qualifiers
FT   CDS             complement(52588..53598)
FT                   /locus_tag="Aaci_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mxa:MXAN_7114 ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="GI:258510060"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:8423503"
FT                   /translation="MLMKGLSVAAAAVVVAAGVAAWHAEQHPHAPAQAAASAQGAKPAG
FT                   TVTVYAALTQQNAQALAQAFEAYDPAARVQMVTTGTGALVTRLESEAKAHAIGADMVLL
FT                   ADPTAADTLAAQGILSREKPSAASHLPSADQGANWVGAYVFHDVIVYHKGMSLPVPRSW
FT                   RDLTNAAYKGEVEIGDPSYSGTTMAFVGMMETRYGWNYFETLKQNGAAVQSSVKTVADD
FT                   VASGKVDVGMTNDSAAFTLVKQESPIGVVWPQDGAIVVPGPLAFVKGHETPVAKAFANW
FT                   LLSPAGQKVVASVGLSPVLGASPTVPKGASLTQVPWAQLERDRANILREFAQIFR"
FT                   /protein_id="YP_003183494.1"
     MLMKGLSVAA AAVVVAAGVA AWHAEQHPHA PAQAAASAQG AKPAGTVTVY AALTQQNAQA        60
     LAQAFEAYDP AARVQMVTTG TGALVTRLES EAKAHAIGAD MVLLADPTAA DTLAAQGILS       120
     REKPSAASHL PSADQGANWV GAYVFHDVIV YHKGMSLPVP RSWRDLTNAA YKGEVEIGDP       180
     SYSGTTMAFV GMMETRYGWN YFETLKQNGA AVQSSVKTVA DDVASGKVDV GMTNDSAAFT       240
     LVKQESPIGV VWPQDGAIVV PGPLAFVKGH ETPVAKAFAN WLLSPAGQKV VASVGLSPVL       300
     GASPTVPKGA SLTQVPWAQL ERDRANILRE FAQIFR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page