(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE41

ALIAD_1.PE41         Location/Qualifiers
FT   CDS             complement(53713..54513)
FT                   /locus_tag="Aaci_0042"
FT                   /gene_family="HOG000276829" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /codon_start="1"
FT                   /product="ABC-2 type transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ank:AnaeK_4023
FT                   ABC-2 type transporter"
FT                   /db_xref="GI:258510061"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR013526"
FT                   /db_xref="GeneID:8423504"
FT                   /translation="MQQTSFEAIQARASMATTLRQSLTMAYRGLLKMRRTPEQLFDVTL
FT                   QPIIFTLMFTYIFGGAISGNSQNYLPLVIPGILVQTVITASVVTGVQLREDMDKGVFDR
FT                   FRALPIARMAPLAGALLADMVRYLLATVLIFTVGYLMGYHPRGGLAHVAIAALLVIVCA
FT                   FALSWIFAFFGVVARTAASVQGISMLILFPLTFLSNAFAPVNTMPKWLQVFVNVNPLSH
FT                   LIAAVRSLANQGQATPDIAISLGGAVAIMLVFAPLAVRMYMRKA"
FT                   /protein_id="YP_003183495.1"
     MQQTSFEAIQ ARASMATTLR QSLTMAYRGL LKMRRTPEQL FDVTLQPIIF TLMFTYIFGG        60
     AISGNSQNYL PLVIPGILVQ TVITASVVTG VQLREDMDKG VFDRFRALPI ARMAPLAGAL       120
     LADMVRYLLA TVLIFTVGYL MGYHPRGGLA HVAIAALLVI VCAFALSWIF AFFGVVARTA       180
     ASVQGISMLI LFPLTFLSNA FAPVNTMPKW LQVFVNVNPL SHLIAAVRSL ANQGQATPDI       240
     AISLGGAVAI MLVFAPLAVR MYMRKA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page