(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE43

ALIAD_1.PE43         Location/Qualifiers
FT   CDS             55675..56349
FT                   /locus_tag="Aaci_0044"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: dds:Ddes_0567 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="GI:258510063"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:8423506"
FT                   /translation="MATILVADDEPHIRELVRSTLEREGHRVVEAADGREAADAVAREP
FT                   VQLAVIDVMMPEVDGFELTRWLREERDVPILLLTALGETSHKVRGLRLGADDYLVKPFA
FT                   PEELVARVEALLRRYRIRADGALDLAVLRLLSDTYEVEANGERMALPPKEFQLLFTLAA
FT                   SAGRTLSRDKLIEEVWGYDYAGDERTVDVHIKRLRVKFPEDVYPFRIRTVRGLGYRLEV
FT                   NA"
FT                   /protein_id="YP_003183497.1"
     MATILVADDE PHIRELVRST LEREGHRVVE AADGREAADA VAREPVQLAV IDVMMPEVDG        60
     FELTRWLREE RDVPILLLTA LGETSHKVRG LRLGADDYLV KPFAPEELVA RVEALLRRYR       120
     IRADGALDLA VLRLLSDTYE VEANGERMAL PPKEFQLLFT LAASAGRTLS RDKLIEEVWG       180
     YDYAGDERTV DVHIKRLRVK FPEDVYPFRI RTVRGLGYRL EVNA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page