(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE44

ALIAD_1.PE44         Location/Qualifiers
FT   CDS             56346..57458
FT                   /locus_tag="Aaci_0045"
FT                   /gene_family="HOG000079356" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: gsu:GSU1101 sensory box histidine kinase"
FT                   /db_xref="GI:258510064"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:8423507"
FT                   /translation="MKERAASRGSDDDFRARHQRWQWREALDRLLWMSCWSFVLLSASY
FT                   GVVRLMGRALGWRPVPYGQLMIIGGVGVVMLALVALLWNALGFDRDDRLFFRILDSLSE
FT                   IGRGNFSARAMLEVRRGFPDHPMNQLVLHVREMAEGLERIEQMRQEFVANVSHEMQTPL
FT                   TSILGFVKALKSDGLSEGERRHYLDIIEAESERLSRLADNLLKLTSLESGHHPVTLTRF
FT                   RLDRQLREVAIACEPLWTEKGLFLDMQVEPVELEGDEDLLGQVWMNLLSNAIKFTEPGG
FT                   RIQVRLEKEETGVCVSVADTGIGIRPEDVSRVFTRFFKADRSRGKPGNGLGLAIAKRIV
FT                   EMHRGDISVESEPGRGSTFKVHLPYTQGGR"
FT                   /protein_id="YP_003183498.1"
     MKERAASRGS DDDFRARHQR WQWREALDRL LWMSCWSFVL LSASYGVVRL MGRALGWRPV        60
     PYGQLMIIGG VGVVMLALVA LLWNALGFDR DDRLFFRILD SLSEIGRGNF SARAMLEVRR       120
     GFPDHPMNQL VLHVREMAEG LERIEQMRQE FVANVSHEMQ TPLTSILGFV KALKSDGLSE       180
     GERRHYLDII EAESERLSRL ADNLLKLTSL ESGHHPVTLT RFRLDRQLRE VAIACEPLWT       240
     EKGLFLDMQV EPVELEGDED LLGQVWMNLL SNAIKFTEPG GRIQVRLEKE ETGVCVSVAD       300
     TGIGIRPEDV SRVFTRFFKA DRSRGKPGNG LGLAIAKRIV EMHRGDISVE SEPGRGSTFK       360
     VHLPYTQGGR                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page