(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE46

ALIAD_1.PE46         Location/Qualifiers
FT   CDS             57744..58364
FT                   /locus_tag="Aaci_0047"
FT                   /gene_family="HOG000122947" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /codon_start="1"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /transl_table="11"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rfe:RF_0832 lysine efflux permease"
FT                   /db_xref="GI:258510066"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="GeneID:8423509"
FT                   /translation="MVGAFWHGLILAFALILPIGMQNGFLLSQGALHRRWLAALPAVVT
FT                   AALCDTFLVALAVFGVSGAVFHIVWLRVALGMVGVAFLLYMGFQTWRQNPDDHAVTSEV
FT                   WSPRRQIGFAMSVSLLNPHALMDTLAVIGGSAAVYGTWGQRASFAAGCALVSWVWFFFL
FT                   MTLGHVAGRAAAGVGLRRVINRISALMMWASAGLLIHILLTFR"
FT                   /protein_id="YP_003183500.1"
     MVGAFWHGLI LAFALILPIG MQNGFLLSQG ALHRRWLAAL PAVVTAALCD TFLVALAVFG        60
     VSGAVFHIVW LRVALGMVGV AFLLYMGFQT WRQNPDDHAV TSEVWSPRRQ IGFAMSVSLL       120
     NPHALMDTLA VIGGSAAVYG TWGQRASFAA GCALVSWVWF FFLMTLGHVA GRAAAGVGLR       180
     RVINRISALM MWASAGLLIH ILLTFR                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page