(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE47

ALIAD_1.PE47         Location/Qualifiers
FT   CDS             complement(58517..61396)
FT                   /locus_tag="Aaci_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG3534"
FT                   /codon_start="1"
FT                   /product="Alpha-L-arabinofuranosidase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: esa:ESA_01942 hypothetical protein"
FT                   /db_xref="GI:258510067"
FT                   /db_xref="GeneID:8423510"
FT                   /translation="MKRPWSAALAALIALGTGASPAWAAAHPSPKVPAGAAGRVRAADV
FT                   VSTPISMEIQVIHDALTVPELAAVQAAAQAASNLSTSQWLQWLYPNATPTTSAQSQAAQ
FT                   AVANLFNLATYGAVSTRGSNAAQILQTLQSISPLLSPRAVGLFYQSFLTEIGQSSKAIL
FT                   ARQASSSIVGNALAQAASLSPTISAYLRQNGLSPSDLARTWSSFETQVDPQGAAQTALA
FT                   TRICTNALGFGAPTASATITVNTAARLRTVPATAFGLNAAVWDSGLNSQTVISEVQALH
FT                   PALIRWPGGSISDVYNWETNTRNDGGYVNPNDTFDNFMQFVNAVGASPIITVNYGTGTP
FT                   QLAADWVKYADVTHHDNVLYWEIGNEIYGNGYYNGNGWEADDHAVPNQPQKGNPGLSPQ
FT                   AYAQNALQFIQAMRAVDPNIKIGAVLTMPYNWPWGATVNGNDDWNTVVLKALGPYIDFV
FT                   DVHWYPETPGQETDAGLLADTDQIPAMVAELKREINAYAGSNAKNIQIFVTETNSVSYN
FT                   PGQQSTNLPEALFLADDLAGFVQAGAANVDWWDLLNGAEDNYTSPSLYGQNLFGDYGLL
FT                   SSGQATPKGVQEPPQYTPLPPYYGFQLVSDFARPGDTLLGSASSQSDIDVHAVREPNGD
FT                   IALMLVNRSPSTIYSADLNVLGVGPYAITKALVYGEGSSAVSPALTLPTAHSVKLMPYS
FT                   GVDLVLHPLIPAPHAAASVTDTLALSSPTVTAGGSETVTASFSSDRPVRDATVELELYD
FT                   STGDLVANHEMTGVDIAPGQPVSESWTFAAPAANGTYTVEAFAFDPATGATYDADTTGA
FT                   TITVNQPPAAKYGDIVTKNTVITVNGTTYTVPAPDASGHYPSGTNISIAPGDTVTIQTT
FT                   FANVSSTDALQNGLIDMEVDGQNGAIFQKYWPSTTLLPGQTETVTATWQVPSSVSAGTY
FT                   PLNFQAFDTSNWTGNCYFTNGGVVNFVVN"
FT                   /protein_id="YP_003183501.1"
     MKRPWSAALA ALIALGTGAS PAWAAAHPSP KVPAGAAGRV RAADVVSTPI SMEIQVIHDA        60
     LTVPELAAVQ AAAQAASNLS TSQWLQWLYP NATPTTSAQS QAAQAVANLF NLATYGAVST       120
     RGSNAAQILQ TLQSISPLLS PRAVGLFYQS FLTEIGQSSK AILARQASSS IVGNALAQAA       180
     SLSPTISAYL RQNGLSPSDL ARTWSSFETQ VDPQGAAQTA LATRICTNAL GFGAPTASAT       240
     ITVNTAARLR TVPATAFGLN AAVWDSGLNS QTVISEVQAL HPALIRWPGG SISDVYNWET       300
     NTRNDGGYVN PNDTFDNFMQ FVNAVGASPI ITVNYGTGTP QLAADWVKYA DVTHHDNVLY       360
     WEIGNEIYGN GYYNGNGWEA DDHAVPNQPQ KGNPGLSPQA YAQNALQFIQ AMRAVDPNIK       420
     IGAVLTMPYN WPWGATVNGN DDWNTVVLKA LGPYIDFVDV HWYPETPGQE TDAGLLADTD       480
     QIPAMVAELK REINAYAGSN AKNIQIFVTE TNSVSYNPGQ QSTNLPEALF LADDLAGFVQ       540
     AGAANVDWWD LLNGAEDNYT SPSLYGQNLF GDYGLLSSGQ ATPKGVQEPP QYTPLPPYYG       600
     FQLVSDFARP GDTLLGSASS QSDIDVHAVR EPNGDIALML VNRSPSTIYS ADLNVLGVGP       660
     YAITKALVYG EGSSAVSPAL TLPTAHSVKL MPYSGVDLVL HPLIPAPHAA ASVTDTLALS       720
     SPTVTAGGSE TVTASFSSDR PVRDATVELE LYDSTGDLVA NHEMTGVDIA PGQPVSESWT       780
     FAAPAANGTY TVEAFAFDPA TGATYDADTT GATITVNQPP AAKYGDIVTK NTVITVNGTT       840
     YTVPAPDASG HYPSGTNISI APGDTVTIQT TFANVSSTDA LQNGLIDMEV DGQNGAIFQK       900
     YWPSTTLLPG QTETVTATWQ VPSSVSAGTY PLNFQAFDTS NWTGNCYFTN GGVVNFVVN        959
//

If you have problems or comments...

PBIL Back to PBIL home page