(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE49

ALIAD_1.PE49         Location/Qualifiers
FT   CDS             62582..63133
FT                   /locus_tag="Aaci_0050"
FT                   /gene_family="HOG000011232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04309"
FT                   /codon_start="1"
FT                   /product="glycerol-3-phosphate responsive antiterminator,
FT                   GlpP"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerol-3-phosphate responsive
FT                   antiterminator; KEGG: kpe:KPK_4466 glycerol-3-phosphate
FT                   responsive antiterminator"
FT                   /db_xref="GI:258510069"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="GeneID:8423512"
FT                   /translation="MNPFEGRRVLPAVRSLKDFEELMQGPHPVVVLLETNLTALPSLMR
FT                   MANKAGKRLILHADLIQGLKHDEAGTQFLCQMIRPYGIISTHASVIATAKKQGVIAIQR
FT                   VFLIDSHSLRTSYRVLQQAKPDFLEVLPGVVPQLIAEIREQTGLPVLAGGFVRTKEDVE
FT                   RAVAAGATAVTTSVKALWQL"
FT                   /protein_id="YP_003183503.1"
     MNPFEGRRVL PAVRSLKDFE ELMQGPHPVV VLLETNLTAL PSLMRMANKA GKRLILHADL        60
     IQGLKHDEAG TQFLCQMIRP YGIISTHASV IATAKKQGVI AIQRVFLIDS HSLRTSYRVL       120
     QQAKPDFLEV LPGVVPQLIA EIREQTGLPV LAGGFVRTKE DVERAVAAGA TAVTTSVKAL       180
     WQL                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page