(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE5

ALIAD_1.PE5          Location/Qualifiers
FT   CDS             4233..6146
FT                   /locus_tag="Aaci_0005"
FT                   /gene_family="HOG000075154" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: glo:Glov_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:258510025"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="GeneID:8423463"
FT                   /translation="MADRIPEQVYDESQIEVLEGLQAVRKRPGMYIGSTSAKGLHHLVW
FT                   EIVDNAVDEALAGRCTRIVVQVHPDNSVTVIDNGAGFPVGIHPKTGRPAVETVLTTLHA
FT                   GGKFGGKGYKVSGGLHGVGASVVNALSEWMRVEVHRDGRIYVQEYERGTPLYDLKVIGT
FT                   TDKTGTKVSFKPDPEIFTETTVFSAETLMNRLRELAFLNAGLEIVFEDEREGGKRAVFK
FT                   YDGGVAEFVRWLNQSKDVLFDDPIYVSAVKDDVAVEIALQYNDGYAATVYSFANNINTA
FT                   EGGTHEAGFKSALTRVINDYARRYGFLKSNDNSMTGDDVREGLTAVVSVKVPEPQFEGQ
FT                   TKTKLGNSEVRGIVETLFAERMQMFLEENPSIARKIVEKCILAARAREAARRARELTRS
FT                   KKMDVTSLPGKLTDCSSKDPERSELFLVEGDSAGGSAKMGRDPQTQAILPLRGKIINVE
FT                   KARLDKVLANEEIRAIITACGTGIGDDFDISKARYHKIVIMTDADHDGSHIRILLLTLF
FT                   YRFMRPLIDAGYIYIAQPPLYKIEKGKVVRYAYSDAQLEQILQEMGREGVRLQRYKGLG
FT                   EMNADQLWETTMDPESRTLLRVTMEDAMDADMIFSILMGDKVEPRRDFIAEHARFVRNL
FT                   DV"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_003183459.1"
     MADRIPEQVY DESQIEVLEG LQAVRKRPGM YIGSTSAKGL HHLVWEIVDN AVDEALAGRC        60
     TRIVVQVHPD NSVTVIDNGA GFPVGIHPKT GRPAVETVLT TLHAGGKFGG KGYKVSGGLH       120
     GVGASVVNAL SEWMRVEVHR DGRIYVQEYE RGTPLYDLKV IGTTDKTGTK VSFKPDPEIF       180
     TETTVFSAET LMNRLRELAF LNAGLEIVFE DEREGGKRAV FKYDGGVAEF VRWLNQSKDV       240
     LFDDPIYVSA VKDDVAVEIA LQYNDGYAAT VYSFANNINT AEGGTHEAGF KSALTRVIND       300
     YARRYGFLKS NDNSMTGDDV REGLTAVVSV KVPEPQFEGQ TKTKLGNSEV RGIVETLFAE       360
     RMQMFLEENP SIARKIVEKC ILAARAREAA RRARELTRSK KMDVTSLPGK LTDCSSKDPE       420
     RSELFLVEGD SAGGSAKMGR DPQTQAILPL RGKIINVEKA RLDKVLANEE IRAIITACGT       480
     GIGDDFDISK ARYHKIVIMT DADHDGSHIR ILLLTLFYRF MRPLIDAGYI YIAQPPLYKI       540
     EKGKVVRYAY SDAQLEQILQ EMGREGVRLQ RYKGLGEMNA DQLWETTMDP ESRTLLRVTM       600
     EDAMDADMIF SILMGDKVEP RRDFIAEHAR FVRNLDV                                637
//

If you have problems or comments...

PBIL Back to PBIL home page