(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE50

ALIAD_1.PE50         Location/Qualifiers
FT   CDS             complement(63154..64875)
FT                   /locus_tag="Aaci_0051"
FT                   /gene_family="HOG000239127" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dal:Dalk_2314 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="GI:258510070"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:8423513"
FT                   /translation="MRILDARSPAYKWIALSNTTLGVLMASINGTILIIALPVIFAGIQ
FT                   VNPLQSGQTSLLLWVLMGFNVATTVLLVTFGRLSDMFGRVRLYNLGFLVFTVGSVLCSL
FT                   TWSHGRAGELELIIFRMIQGIGGAFLFSNSAAILTDAFPNNQRGLALGLNQIAAVAGSV
FT                   VGLVLGGILASTGHWRYVFLVNVPIGIIGTVWAYLMLKEMAKPQRDAKLDIPGNATLAL
FT                   GVLALMLALTYGIMPYGGHSMGWTSPMVLALFIGGVVMLGVFGVIERRMPDPLFRLELF
FT                   RIRPFTLGNVALFMGSLARGGLSFMLIIWLQGIYLPLHGVSYENTPLIAGLYTLPQMVG
FT                   FLAAGPLSGYLSDKFGQRAFATGGLLVSAVGFLLLAALPIDFNRFAFWADIFVIGVGMG
FT                   LFASPNNASIMSSVPAQYRGVASGMRSTFNNAGQMMSMGIFFSIVVAGLAAKLPQALVS
FT                   GLTAHGVPVKAAEAIAKLPPTSSLFAALLGYNPLESLLGPNGLNVLSKLPASQVAAITG
FT                   KHFFPTLISPPFHTGLALAFVISAILMVIGAVASIFRGTYQEPQAMSPREAERVAK"
FT                   /protein_id="YP_003183504.1"
     MRILDARSPA YKWIALSNTT LGVLMASING TILIIALPVI FAGIQVNPLQ SGQTSLLLWV        60
     LMGFNVATTV LLVTFGRLSD MFGRVRLYNL GFLVFTVGSV LCSLTWSHGR AGELELIIFR       120
     MIQGIGGAFL FSNSAAILTD AFPNNQRGLA LGLNQIAAVA GSVVGLVLGG ILASTGHWRY       180
     VFLVNVPIGI IGTVWAYLML KEMAKPQRDA KLDIPGNATL ALGVLALMLA LTYGIMPYGG       240
     HSMGWTSPMV LALFIGGVVM LGVFGVIERR MPDPLFRLEL FRIRPFTLGN VALFMGSLAR       300
     GGLSFMLIIW LQGIYLPLHG VSYENTPLIA GLYTLPQMVG FLAAGPLSGY LSDKFGQRAF       360
     ATGGLLVSAV GFLLLAALPI DFNRFAFWAD IFVIGVGMGL FASPNNASIM SSVPAQYRGV       420
     ASGMRSTFNN AGQMMSMGIF FSIVVAGLAA KLPQALVSGL TAHGVPVKAA EAIAKLPPTS       480
     SLFAALLGYN PLESLLGPNG LNVLSKLPAS QVAAITGKHF FPTLISPPFH TGLALAFVIS       540
     AILMVIGAVA SIFRGTYQEP QAMSPREAER VAK                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page