(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE51

ALIAD_1.PE51         Location/Qualifiers
FT   CDS             complement(64872..65345)
FT                   /locus_tag="Aaci_0052"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MerR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: bpy:Bphyt_1823 transcriptional
FT                   regulator, MerR family"
FT                   /db_xref="GI:258510071"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="GeneID:8423514"
FT                   /translation="MDRDKAWTVEAVAERLGITPRTLHYYEEKGLIPEVPRTPGGHRVY
FT                   DEDTIERIEHILRLKEALGYSLQEIRSILSTEDQLKAYRARIAEGHEPEHNVQMLSESV
FT                   RLLEDVVRHIDEKMLRLGSMREHYMDRLARIRARLEREEAATRTVGFPDQEGE"
FT                   /protein_id="YP_003183505.1"
     MDRDKAWTVE AVAERLGITP RTLHYYEEKG LIPEVPRTPG GHRVYDEDTI ERIEHILRLK        60
     EALGYSLQEI RSILSTEDQL KAYRARIAEG HEPEHNVQML SESVRLLEDV VRHIDEKMLR       120
     LGSMREHYMD RLARIRARLE REEAATRTVG FPDQEGE                                157
//

If you have problems or comments...

PBIL Back to PBIL home page