(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE53

ALIAD_1.PE53         Location/Qualifiers
FT   CDS             68319..68954
FT                   /locus_tag="Aaci_0054"
FT                   /gene_family="HOG000101079" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /codon_start="1"
FT                   /product="Putitive phosphate transport regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   dar:Daro_0678 phosphate transport regulator- like protein"
FT                   /db_xref="GI:258510073"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="GeneID:8423516"
FT                   /translation="MSKLAQWLRPHESRFFALLEAQARQAQRGVHLLGEIVEMKPGEAE
FT                   LRRYAERMRVLEQEGDAIRRNVIEELIRSFMTPMDREDIYDLSRSLDDILDYAHTTVQE
FT                   FLVYAIPFEPAIHEMAGALKEGVDALAEAVAGLVKPGPSVHAAIVRAKKMENRMEELYR
FT                   ESNAELFLSQDVHHIFRMREVYRHLSNAADRLDRAADMVGSILIKGLG"
FT                   /protein_id="YP_003183507.1"
     MSKLAQWLRP HESRFFALLE AQARQAQRGV HLLGEIVEMK PGEAELRRYA ERMRVLEQEG        60
     DAIRRNVIEE LIRSFMTPMD REDIYDLSRS LDDILDYAHT TVQEFLVYAI PFEPAIHEMA       120
     GALKEGVDAL AEAVAGLVKP GPSVHAAIVR AKKMENRMEE LYRESNAELF LSQDVHHIFR       180
     MREVYRHLSN AADRLDRAAD MVGSILIKGL G                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page