(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE54

ALIAD_1.PE54         Location/Qualifiers
FT   CDS             69155..70660
FT                   /locus_tag="Aaci_0055"
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /codon_start="1"
FT                   /product="glycerol kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: Carbohydrate kinase,
FT                   FGGY-like; KEGG: hha:Hhal_0078 glycerol kinase"
FT                   /db_xref="GI:258510074"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="GeneID:8423517"
FT                   /translation="MDARTFILAFDQGTTSSRAILFDRAGRIHSIAQKEFTQIYPKPGW
FT                   VEHDPMEIWGTQSGVAREVLEKAAVSPEQVAAIGITNQRETTVVWDKETGKPVYNAIVW
FT                   QDRRTADICDELKAAGHADAIRDKTGLVIDAYFSGTKIKWILDHVEGARERAERGELLF
FT                   GTIDTWLVWNLTRGKVHVTDYTNASRTMLFNIHTLDWDDDLLKLLGIPRAMLPEVRPSS
FT                   SIYGHTDEHTFGGANIPIAGIAGDQQAALFGQTCFEPGMVKNTYGTGCFMLMNTGEKPV
FT                   ASPSGLLTTIAWGLDGKVTYALEGSVFIAGAAIQWLRDGLRFFDAAADSEYFASKVEDT
FT                   GGVYVVPAFAGLGAPYWDMYARGAIFGLTRGTRKEHIIRATLDSLAYQTKDILDAMQRD
FT                   SGIELKSLRVDGGAVANNLLMQFQADILGVPVERPRITESTALGAAYLAGLAVGFWSKD
FT                   EIARSGDIERRFDPQMDAETRARLYRGWQRAVERTMGWAQEDI"
FT                   /protein_id="YP_003183508.1"
     MDARTFILAF DQGTTSSRAI LFDRAGRIHS IAQKEFTQIY PKPGWVEHDP MEIWGTQSGV        60
     AREVLEKAAV SPEQVAAIGI TNQRETTVVW DKETGKPVYN AIVWQDRRTA DICDELKAAG       120
     HADAIRDKTG LVIDAYFSGT KIKWILDHVE GARERAERGE LLFGTIDTWL VWNLTRGKVH       180
     VTDYTNASRT MLFNIHTLDW DDDLLKLLGI PRAMLPEVRP SSSIYGHTDE HTFGGANIPI       240
     AGIAGDQQAA LFGQTCFEPG MVKNTYGTGC FMLMNTGEKP VASPSGLLTT IAWGLDGKVT       300
     YALEGSVFIA GAAIQWLRDG LRFFDAAADS EYFASKVEDT GGVYVVPAFA GLGAPYWDMY       360
     ARGAIFGLTR GTRKEHIIRA TLDSLAYQTK DILDAMQRDS GIELKSLRVD GGAVANNLLM       420
     QFQADILGVP VERPRITEST ALGAAYLAGL AVGFWSKDEI ARSGDIERRF DPQMDAETRA       480
     RLYRGWQRAV ERTMGWAQED I                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page