(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE55

ALIAD_1.PE55         Location/Qualifiers
FT   CDS             70814..72508
FT                   /locus_tag="Aaci_0056"
FT                   /gene_family="HOG000004812" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mxa:MXAN_7329 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="GI:258510075"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:8423518"
FT                   /translation="MAEGRFSIAARSAIKAEMAGEPLDLLIIGGGITGAGILLDATARG
FT                   MKAALVEMQDFAAGTSNRSTKLVHGGLRYLKQFEVGLVAEVGKERAIVYENGPHITTPV
FT                   WMLLPIIEGGTYGWLATSVGIYIYDKLAGVKRSERRKMLSAEQALEIEPLLRREGLKGA
FT                   GYYVEYRTDDARLTLEILKKAVEMSGLALNYAKATGFLYDHGRVAGAEVEDVLSGETFI
FT                   VRAKKVVNATGPWVDELREKDGSKSGKTLHHTKGVHIVVDGKRFPLRNSVYFDVPDGRM
FT                   VFAIPRDGKTYIGTTDTDYHGDLVHPRMTKADRDYLIDCVNSMFPSVKLTAADIESSWA
FT                   GVRPLIHEEGKDPSEISRKDEVFVSPSGLLTIAGGKLTGYRKMAEKVVDMVARDLAEDG
FT                   RRFGPCTTDKIPYSGGDFGGSDKMPAFVEDRVQRGVKLGLAEEDARRLARRYGTNVDLV
FT                   FNLLASGRDRAEAHGLRLDVYAELEYGLRHEMVATPSDFFIRRTGALYFDIDWVRENQN
FT                   AVIRYMAAACGWSEEETERHARELQARVLEATTVEEDIPASGNLVGA"
FT                   /protein_id="YP_003183509.1"
     MAEGRFSIAA RSAIKAEMAG EPLDLLIIGG GITGAGILLD ATARGMKAAL VEMQDFAAGT        60
     SNRSTKLVHG GLRYLKQFEV GLVAEVGKER AIVYENGPHI TTPVWMLLPI IEGGTYGWLA       120
     TSVGIYIYDK LAGVKRSERR KMLSAEQALE IEPLLRREGL KGAGYYVEYR TDDARLTLEI       180
     LKKAVEMSGL ALNYAKATGF LYDHGRVAGA EVEDVLSGET FIVRAKKVVN ATGPWVDELR       240
     EKDGSKSGKT LHHTKGVHIV VDGKRFPLRN SVYFDVPDGR MVFAIPRDGK TYIGTTDTDY       300
     HGDLVHPRMT KADRDYLIDC VNSMFPSVKL TAADIESSWA GVRPLIHEEG KDPSEISRKD       360
     EVFVSPSGLL TIAGGKLTGY RKMAEKVVDM VARDLAEDGR RFGPCTTDKI PYSGGDFGGS       420
     DKMPAFVEDR VQRGVKLGLA EEDARRLARR YGTNVDLVFN LLASGRDRAE AHGLRLDVYA       480
     ELEYGLRHEM VATPSDFFIR RTGALYFDID WVRENQNAVI RYMAAACGWS EEETERHARE       540
     LQARVLEATT VEEDIPASGN LVGA                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page