(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE56

ALIAD_1.PE56         Location/Qualifiers
FT   CDS             72699..74579
FT                   /locus_tag="Aaci_0057"
FT                   /gene_family="HOG000086348" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /codon_start="1"
FT                   /product="Peptidase S53 propeptide"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase S53 propeptide; peptidase S8 and S53
FT                   subtilisin kexin sedolisin; KEGG: cvi:CV_3519 periplasmic
FT                   aspartyl protease"
FT                   /db_xref="GI:258510076"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="GeneID:8423519"
FT                   /translation="MGLWKRLAFGLPAALGMLAVGVPTMDADAVQAAPLANPSTENAQD
FT                   LGPANASQTVTASVILHVQNPTALQNYIQQTETPGSAQYHKFLTTSQFAAQFAPSDQTI
FT                   QQIEQELEQYGLQVVNVSADHLDLQVQGTIQQFDHAFNTVIDLFKANGQVFRAPKKPPQ
FT                   IPVALLTNVLAVVGLDTANAAQSLTVKTPHVSGMPSPKAVLPQGGSTATGTPGSYTVGD
FT                   TANRYDVNPLYQKGITGKGETVGIVTLSSFNPQDAYTYWKGIGLHVAQNRIQMVNVDGG
FT                   GQMDDGSVETALDVEQAGGIAPDANVVVYDAPNTDQGFIDAFYQAVSDNQVDSLSVSWG
FT                   QPEIDYLPQMNQGQSYVDELLAFTQAFMEAAAQGISVYAAAGDSGAYDTARDFPPSQGF
FT                   STPLTVDFPASDPFVTAAGGTTVPFSATFSLGKVNITQEQPWSWQYLQNLGYQGLFPIG
FT                   TGGGVSVIFPRPWYQNGVSGVQNSAANQAFTDSQGVLYGSPFTYNLPSNYPGRNLPDVS
FT                   MDADPETGYLVYWSAGGGWLAGYGGTSFVAPQLNGITALIDQYVGGRVGFLDPVFYQLM
FT                   QQNGYGANQPFNDLTTGNNWYWSAVPGYDRASGIGTPNVANLAQAIKSMG"
FT                   /protein_id="YP_003183510.1"
     MGLWKRLAFG LPAALGMLAV GVPTMDADAV QAAPLANPST ENAQDLGPAN ASQTVTASVI        60
     LHVQNPTALQ NYIQQTETPG SAQYHKFLTT SQFAAQFAPS DQTIQQIEQE LEQYGLQVVN       120
     VSADHLDLQV QGTIQQFDHA FNTVIDLFKA NGQVFRAPKK PPQIPVALLT NVLAVVGLDT       180
     ANAAQSLTVK TPHVSGMPSP KAVLPQGGST ATGTPGSYTV GDTANRYDVN PLYQKGITGK       240
     GETVGIVTLS SFNPQDAYTY WKGIGLHVAQ NRIQMVNVDG GGQMDDGSVE TALDVEQAGG       300
     IAPDANVVVY DAPNTDQGFI DAFYQAVSDN QVDSLSVSWG QPEIDYLPQM NQGQSYVDEL       360
     LAFTQAFMEA AAQGISVYAA AGDSGAYDTA RDFPPSQGFS TPLTVDFPAS DPFVTAAGGT       420
     TVPFSATFSL GKVNITQEQP WSWQYLQNLG YQGLFPIGTG GGVSVIFPRP WYQNGVSGVQ       480
     NSAANQAFTD SQGVLYGSPF TYNLPSNYPG RNLPDVSMDA DPETGYLVYW SAGGGWLAGY       540
     GGTSFVAPQL NGITALIDQY VGGRVGFLDP VFYQLMQQNG YGANQPFNDL TTGNNWYWSA       600
     VPGYDRASGI GTPNVANLAQ AIKSMG                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page