(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE58

ALIAD_1.PE58         Location/Qualifiers
FT   CDS             75440..76207
FT                   /locus_tag="Aaci_0059"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   sde:Sde_1283 2-deoxy-D-gluconate 3- dehydrogenase"
FT                   /db_xref="GI:258510078"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002424"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:8423521"
FT                   /translation="MRLQDKVALVTGGGRGIGAAIARRFAQEGADVCLVSRTEAELEAQ
FT                   AQWIASQTGRAALPVVCDVSNPADVERAVAAAEERFGRIDILVNAAGISVAAPSTDLSF
FT                   DRWKACLNINLDGTFLFCQAVGRGMIARGQGGKIINITSVVAHAGIPERATYAASKGGV
FT                   RQLTQALAVEWAKHNIQVNAISPGFIMTEIVRDYIRRGIHKPEKLVARIPAGRMGQPDD
FT                   IAGPAVFLASSDSDYVTGTILIADGGFLANGYV"
FT                   /protein_id="YP_003183512.1"
     MRLQDKVALV TGGGRGIGAA IARRFAQEGA DVCLVSRTEA ELEAQAQWIA SQTGRAALPV        60
     VCDVSNPADV ERAVAAAEER FGRIDILVNA AGISVAAPST DLSFDRWKAC LNINLDGTFL       120
     FCQAVGRGMI ARGQGGKIIN ITSVVAHAGI PERATYAASK GGVRQLTQAL AVEWAKHNIQ       180
     VNAISPGFIM TEIVRDYIRR GIHKPEKLVA RIPAGRMGQP DDIAGPAVFL ASSDSDYVTG       240
     TILIADGGFL ANGYV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page